protein pr (NC_001474) Virus Tagged ORF Clone
CAT#: VC102553
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for propein pr [Dengue virus 2], codon optimized for human cell expression, YP_009164954
View other clones from "Virus" (13)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | protein pr |
Synonyms | DENV_gp1, Dengue, DENV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102553 represents NCBI reference of YP_009164954 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTCATCTCACAACAAGGAACGGAGAACCACATATGATAGTAAGTCGGCAGGAAAAAGGAAAGTCAC TCTTGTTTAAAACAGAAGACGGCGTGAATATGTGTACCTTGATGGCCATGGACCTGGGAGAACTTTGCGA GGATACCATTACTTATAAATGTCCACTTTTGCGGCAGAACGAACCCGAAGATATCGATTGTTGGTGTAAT TCTACAAGTACGTGGGTGACATATGGAACGTGTACTACAATGGGCGAACACAGAAGAGAAAAAAGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102553 representing YP_009164954
Red=Cloning sites Green=Tags MFHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPLLRQNEPEDIDCWCN STSTWVTYGTCTTMGEHRREKR myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001474 |
ORF Size | 276 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001474.2, YP_009164954 |
RefSeq ORF | 276 bp |
MW | 10.7 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102541 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739581 |
USD 165.00 |
|
VC102542 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739591 |
USD 165.00 |
|
VC102543 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Dengue virus 2], codon optimized for human cell expression, NP_739582 |
USD 330.00 |
|
VC102544 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein M [Dengue virus 2], codon optimized for human cell expression, NP_739592 |
USD 165.00 |
|
VC102545 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Dengue virus 2], codon optimized for human cell expression, NP_739583 |
USD 457.00 |
|
VC102546 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Dengue virus 2], codon optimized for human cell expression, NP_739584 |
USD 503.00 |
|
VC102547 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Dengue virus 2], codon optimized for human cell expression, NP_739585 |
USD 330.00 |
|
VC102548 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Dengue virus 2], codon optimized for human cell expression, NP_739586 |
USD 165.00 |
|
VC102549 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Dengue virus 2], codon optimized for human cell expression, NP_739587 |
USD 634.00 |
|
VC102550 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Dengue virus 2], codon optimized for human cell expression, NP_739588 |
USD 165.00 |
|
VC102551 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Dengue virus 2], codon optimized for human cell expression, NP_739589 |
USD 330.00 |
|
VC102552 | Myc-DDK-tagged ORF clone of viral ORF for RNA-dependent RNA polymerase NS5 [Dengue virus 2], codon optimized for human cell expression, NP_739590 |
USD 907.00 |
|
VC102554 | Myc-DDK-tagged ORF clone of viral ORF for protein 2K [Dengue virus 2], codon optimized for human cell expression, NP_739593 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review