E5b (NC_001355) Virus Tagged ORF Clone
CAT#: VC101998
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E5b protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040302
View other clones from "Virus" (8)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | E5b |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101998 represents NCBI reference of NP_040302 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGCTCACCTGCCAGTTTAACGACGGCGACACTTGGCTGGGTCTGTGGCTTCTGTGCGCTTTTATTG TAGGCATGCTGGGATTGCTGCTGATGCATTATAGAGCCGTGCAGGGGGACAAGCACACGAAGTGTAAAAA GTGCAACAAACACAACTGTAACGACGATTATGTGACAATGCATTACACTACAGATGGGGACTATATCTAT ATGAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101998 representing NP_040302
Red=Cloning sites Green=Tags MMLTCQFNDGDTWLGLWLLCAFIVGMLGLLLMHYRAVQGDKHTKCKKCNKHNCNDDYVTMHYTTDGDYIY MN TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001355 |
ORF Size | 216 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001355.1, NP_040302 |
RefSeq ORF | 216 bp |
Locus ID | 1489367 |
MW | 8.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101992 | Myc-DDK-tagged ORF clone of viral ORF for E6 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040296 |
USD 165.00 |
|
VC101993 | Myc-DDK-tagged ORF clone of viral ORF for E7 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040297 |
USD 165.00 |
|
VC101994 | Myc-DDK-tagged ORF clone of viral ORF for replication protein E1 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040298 |
USD 664.00 |
|
VC101995 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein E2 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040299 |
USD 503.00 |
|
VC101996 | Myc-DDK-tagged ORF clone of viral ORF for E4 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040300 |
USD 165.00 |
|
VC101997 | Myc-DDK-tagged ORF clone of viral ORF for E5a protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040301 |
USD 165.00 |
|
VC101999 | Myc-DDK-tagged ORF clone of viral ORF for minor capsid protein L2 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040303 |
USD 503.00 |
|
VC102000 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein L1 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040304 |
USD 503.00 |
{0} Product Review(s)
Be the first one to submit a review