ORF69 (NC_009333) Virus Tagged ORF Clone
CAT#: VC101707
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for ORF69 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129427
View other clones from "Virus" (82)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ORF69 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101707 represents NCBI reference of YP_001129427 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCAAATCAGTGTCCTCACATATCTCTCTGGCTACCTCTACTGGGAGATCCGGACCTCGCGACATCC GGCGGTGCCTGAGCAGCCGCCTGCGCTCAGTTCCTCCCGGCGCCCGAAGTGCCAGCGTTTCCTCAAAACA CCGCAACGGATTGCGCAAATTTATCAGTGATAAAGTTTTTTTTAGCATTCTGTCCCACCGGCATGAGCTC GGAGTGGATTTTCTGAGAGAAATGGAAACACCAATCTGTACGAGCAAGACTGTGATGCTTCCATTGGACC TGAGCACAGTGGCCCCGGGAAGATGCGTATCACTCAGCCCCTTCGGCCATAGCTCCAATATGGGCTTTCA GTGCGCGCTGTGCCCCAGCACCGAGAACCCTACTGTGGCTCAGGGGAGCAGACCGCAGACAATGGTGGGA GACGCCCTTAAGAAAAACAACGAGCTGTGTTCTGTCGCCCTGGCCTTCTATCATCATGCGGACAAAGTGA TACAACACAAGACCTTTTATCTGTCACTGTTGAGTCACTCCATGGATGTAGTGCGACAGTCCTTCCTGCA GCCTGGACTGCTCTATGCCAACCTTGTTCTCAAAACTTTTGGCCATGATCCCCTCCCTATTTTTACTACT AACAATGGAATGTTGACTATGTGTATCTTGTTCAAGACTCGAGCCCTCCACCTCGGAGAAACTGCTCTGA GACTGCTCATGGACAACCTCCCAAACTACAAGATCTCAGCCGACTGCTGTAGACAGTCTTACGTTGTGAA ATTCGTGCCAACACACCCTGATACTGCCAGCATTGCAGTGCAGGTGCACACGATCTGTGAAGCAGTGGCC GCCCTCGATTGTACAGACGAAATGAGAGACGACATCCAGAAGGGTACTGCTCTGGTGAACGCTTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101707 representing YP_001129427
Red=Cloning sites Green=Tags MPKSVSSHISLATSTGRSGPRDIRRCLSSRLRSVPPGARSASVSSKHRNGLRKFISDKVFFSILSHRHEL GVDFLREMETPICTSKTVMLPLDLSTVAPGRCVSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVG DALKKNNELCSVALAFYHHADKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTT NNGMLTMCILFKTRALHLGETALRLLMDNLPNYKISADCCRQSYVVKFVPTHPDTASIAVQVHTICEAVA ALDCTDEMRDDIQKGTALVNAL TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_009333 |
ORF Size | 906 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_009333.1, YP_001129427 |
RefSeq ORF | 906 bp |
Locus ID | 4961444 |
UniProt ID | Q2HR82 |
MW | 33.2 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101630 | Myc-DDK-tagged ORF clone of viral ORF for K1 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129350 |
USD 330.00 |
|
VC101631 | Myc-DDK-tagged ORF clone of viral ORF for KCP [Human herpesvirus 8], codon optimized for human cell expression, YP_001129351 |
USD 563.00 |
|
VC101632 | Myc-DDK-tagged ORF clone of viral ORF for ORF6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129352 |
USD 1,084.00 |
|
VC101633 | Myc-DDK-tagged ORF clone of viral ORF for ORF7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129353 |
USD 700.00 |
|
VC101634 | Myc-DDK-tagged ORF clone of viral ORF for ORF8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129354 |
USD 851.00 |
|
VC101635 | Myc-DDK-tagged ORF clone of viral ORF for ORF9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129355 |
USD 969.00 |
|
VC101636 | Myc-DDK-tagged ORF clone of viral ORF for ORF10 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129356 |
USD 503.00 |
|
VC101637 | Myc-DDK-tagged ORF clone of viral ORF for ORF11 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129357 |
USD 503.00 |
|
VC101638 | Myc-DDK-tagged ORF clone of viral ORF for K2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129358 |
USD 450.00 |
|
VC101639 | Myc-DDK-tagged ORF clone of viral ORF for ORF2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129359 |
USD 330.00 |
|
VC101640 | Myc-DDK-tagged ORF clone of viral ORF for K3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129360 |
USD 330.00 |
|
VC101641 | Myc-DDK-tagged ORF clone of viral ORF for ORF70 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129361 |
USD 503.00 |
|
VC101642 | Myc-DDK-tagged ORF clone of viral ORF for K4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129362 |
USD 165.00 |
|
VC101643 | Myc-DDK-tagged ORF clone of viral ORF for K41 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129363 |
USD 165.00 |
|
VC101644 | Myc-DDK-tagged ORF clone of viral ORF for K42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129364 |
USD 330.00 |
|
VC101645 | Myc-DDK-tagged ORF clone of viral ORF for K5 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129365 |
USD 330.00 |
|
VC101646 | Myc-DDK-tagged ORF clone of viral ORF for K6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129366 |
USD 165.00 |
|
VC101647 | Myc-DDK-tagged ORF clone of viral ORF for K7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129367 |
USD 165.00 |
|
VC101648 | Myc-DDK-tagged ORF clone of viral ORF for ORF16 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129368 |
USD 330.00 |
|
VC101649 | Myc-DDK-tagged ORF clone of viral ORF for ORF17 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129369 |
USD 547.00 |
|
VC101650 | Myc-DDK-tagged ORF clone of viral ORF for ORF175 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129370 |
USD 330.00 |
|
VC101651 | Myc-DDK-tagged ORF clone of viral ORF for ORF18 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129371 |
USD 330.00 |
|
VC101652 | Myc-DDK-tagged ORF clone of viral ORF for ORF19 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129372 |
USD 562.00 |
|
VC101653 | Myc-DDK-tagged ORF clone of viral ORF for ORF20 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129373 |
USD 330.00 |
|
VC101654 | Myc-DDK-tagged ORF clone of viral ORF for ORF21 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129374 |
USD 594.00 |
|
VC101655 | Myc-DDK-tagged ORF clone of viral ORF for ORF22 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129375 |
USD 735.00 |
|
VC101656 | Myc-DDK-tagged ORF clone of viral ORF for ORF23 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129376 |
USD 503.00 |
|
VC101657 | Myc-DDK-tagged ORF clone of viral ORF for ORF24 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129377 |
USD 757.00 |
|
VC101658 | Myc-DDK-tagged ORF clone of viral ORF for ORF25 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129378 |
USD 1,295.00 |
|
VC101659 | Myc-DDK-tagged ORF clone of viral ORF for ORF26 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129379 |
USD 330.00 |
|
VC101660 | Myc-DDK-tagged ORF clone of viral ORF for ORF27 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129380 |
USD 330.00 |
|
VC101661 | Myc-DDK-tagged ORF clone of viral ORF for ORF28 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129381 |
USD 165.00 |
|
VC101662 | Myc-DDK-tagged ORF clone of viral ORF for ORF29 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129382 |
USD 692.00 |
|
VC101663 | Myc-DDK-tagged ORF clone of viral ORF for ORF30 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129383 |
USD 165.00 |
|
VC101664 | Myc-DDK-tagged ORF clone of viral ORF for ORF31 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129384 |
USD 330.00 |
|
VC101665 | Myc-DDK-tagged ORF clone of viral ORF for ORF32 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129385 |
USD 503.00 |
|
VC101666 | Myc-DDK-tagged ORF clone of viral ORF for ORF33 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129386 |
USD 503.00 |
|
VC101667 | Myc-DDK-tagged ORF clone of viral ORF for ORF34 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129387 |
USD 330.00 |
|
VC101668 | Myc-DDK-tagged ORF clone of viral ORF for ORF35 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129388 |
USD 165.00 |
|
VC101669 | Myc-DDK-tagged ORF clone of viral ORF for ORF36 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129389 |
USD 503.00 |
|
VC101670 | Myc-DDK-tagged ORF clone of viral ORF for ORF37 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129390 |
USD 503.00 |
|
VC101671 | Myc-DDK-tagged ORF clone of viral ORF for ORF38 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129391 |
USD 165.00 |
|
VC101672 | Myc-DDK-tagged ORF clone of viral ORF for ORF39 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129392 |
USD 503.00 |
|
VC101673 | Myc-DDK-tagged ORF clone of viral ORF for ORF40 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129393 |
USD 674.00 |
|
VC101674 | Myc-DDK-tagged ORF clone of viral ORF for ORF42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129394 |
USD 330.00 |
|
VC101675 | Myc-DDK-tagged ORF clone of viral ORF for ORF43 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129395 |
USD 619.00 |
|
VC101676 | Myc-DDK-tagged ORF clone of viral ORF for ORF44 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129396 |
USD 794.00 |
|
VC101677 | Myc-DDK-tagged ORF clone of viral ORF for ORF45 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129397 |
USD 503.00 |
|
VC101678 | Myc-DDK-tagged ORF clone of viral ORF for ORF46 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129398 |
USD 330.00 |
|
VC101679 | Myc-DDK-tagged ORF clone of viral ORF for ORF47 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129399 |
USD 330.00 |
|
VC101680 | Myc-DDK-tagged ORF clone of viral ORF for ORF48 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129400 |
USD 503.00 |
|
VC101681 | Myc-DDK-tagged ORF clone of viral ORF for ORF50 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129401 |
USD 696.00 |
|
VC101682 | Myc-DDK-tagged ORF clone of viral ORF for ORF49 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129402 |
USD 330.00 |
|
VC101683 | Myc-DDK-tagged ORF clone of viral ORF for K8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129403 |
USD 330.00 |
|
VC101684 | Myc-DDK-tagged ORF clone of viral ORF for K81 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129404 |
USD 330.00 |
|
VC101685 | Myc-DDK-tagged ORF clone of viral ORF for ORF52 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129405 |
USD 165.00 |
|
VC101686 | Myc-DDK-tagged ORF clone of viral ORF for ORF53 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129406 |
USD 165.00 |
|
VC101687 | Myc-DDK-tagged ORF clone of viral ORF for ORF54 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129407 |
USD 330.00 |
|
VC101688 | Myc-DDK-tagged ORF clone of viral ORF for ORF55 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129408 |
USD 330.00 |
|
VC101689 | Myc-DDK-tagged ORF clone of viral ORF for ORF56 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129409 |
USD 849.00 |
|
VC101690 | Myc-DDK-tagged ORF clone of viral ORF for ORF57 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129410 |
USD 503.00 |
|
VC101691 | Myc-DDK-tagged ORF clone of viral ORF for K9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129411 |
USD 457.00 |
|
VC101692 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129412 |
USD 917.00 |
|
VC101693 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129413 |
USD 580.00 |
|
VC101695 | Myc-DDK-tagged ORF clone of viral ORF for ORF58 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129415 |
USD 503.00 |
|
VC101696 | Myc-DDK-tagged ORF clone of viral ORF for ORF59 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129416 |
USD 503.00 |
|
VC101697 | Myc-DDK-tagged ORF clone of viral ORF for ORF60 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129417 |
USD 330.00 |
|
VC101698 | Myc-DDK-tagged ORF clone of viral ORF for ORF61 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129418 |
USD 798.00 |
|
VC101699 | Myc-DDK-tagged ORF clone of viral ORF for ORF62 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129419 |
USD 330.00 |
|
VC101700 | Myc-DDK-tagged ORF clone of viral ORF for ORF63 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129420 |
USD 935.00 |
|
VC101702 | Myc-DDK-tagged ORF clone of viral ORF for ORF65 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129422 |
USD 330.00 |
|
VC101703 | Myc-DDK-tagged ORF clone of viral ORF for ORF66 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129423 |
USD 503.00 |
|
VC101704 | Myc-DDK-tagged ORF clone of viral ORF for ORF67 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129424 |
USD 330.00 |
|
VC101705 | Myc-DDK-tagged ORF clone of viral ORF for ORF67A [Human herpesvirus 8], codon optimized for human cell expression, YP_001129425 |
USD 165.00 |
|
VC101706 | Myc-DDK-tagged ORF clone of viral ORF for ORF68 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129426 |
USD 503.00 |
|
VC101708 | Myc-DDK-tagged ORF clone of viral ORF for K12 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129428 |
USD 165.00 |
|
VC101709 | Myc-DDK-tagged ORF clone of viral ORF for K13 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129429 |
USD 330.00 |
|
VC101710 | Myc-DDK-tagged ORF clone of viral ORF for ORF72 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129430 |
USD 330.00 |
|
VC101712 | Myc-DDK-tagged ORF clone of viral ORF for K14 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129432 |
USD 330.00 |
|
VC101713 | Myc-DDK-tagged ORF clone of viral ORF for ORF74 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129433 |
USD 686.00 |
|
VC101714 | Myc-DDK-tagged ORF clone of viral ORF for ORF75 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129434 |
USD 1,241.00 |
|
VC101715 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129435 |
USD 503.00 |
{0} Product Review(s)
Be the first one to submit a review