E3 CR1-alpha1 (AC_000006) Virus Tagged ORF Clone
CAT#: VC100414
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha1 [Human adenovirus D], codon optimized for human cell expression, AP_000151
View other clones from "Virus" (17)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | E3 CR1-alpha1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100414 represents NCBI reference of AP_000151 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGATTTTCGTGGTCCTGTGTGTCCTTTCACTGATCAAGGCTAAGTTGTTGCAGTATTCCGGGATCC CATGCCGGCGGACCCGAAACAAAACTTTCAATCTGACCAACCAAACTGAGGTGAAGTTCAATTGCCGGCC CGGAGATAAATATATTCTCTGGCTTTTTAAGAATACCAGCTTCGCAGTGTCAAACGCTTGTGCTAATGAC GGCATAGAAATACCTAATAACCTGACCTCCGGCCTCACTTATACCACCAGAAAAACCAAACTGGTTTTGT ACAACCCCTTCGTAGAGGGAACGTATCATTGTCAGAGCGGACCCTGTTTCCACACGTTTACACTTGTTAA CGTCACCGACTCTAGCACAGCCGCCACAGAGACCAGCAACCTCCTGTTCGACACCAATACACCCAAAACA GGTGGAGAACTGTGGGTGCCTAGCTTGACCGAGGGCGGAAAACATATCGAAGCTGTCGGGTACCTGATTC TGGGAGTGGTCTTGGGGGGCTGCATTGCCGTCCTGTACTATTTGCCATGTTGGATTGAGATTAAGATTTT TATTTGCTGGGTGCGGCATTGTTGGGAGGAGCCG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100414 representing AP_000151
Red=Cloning sites Green=Tags MRIFVVLCVLSLIKAKLLQYSGIPCRRTRNKTFNLTNQTEVKFNCRPGDKYILWLFKNTSFAVSNACAND GIEIPNNLTSGLTYTTRKTKLVLYNPFVEGTYHCQSGPCFHTFTLVNVTDSSTAATETSNLLFDTNTPKT GGELWVPSLTEGGKHIEAVGYLILGVVLGGCIAVLYYLPCWIEIKIFICWVRHCWEEP TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | AC_000006 |
ORF Size | 594 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | AC_000006.1, AP_000151 |
RefSeq ORF | 594 bp |
MW | 22.2 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100405 | Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus D], codon optimized for human cell expression, AP_000142 |
USD 330.00 |
|
VC100407 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus D], codon optimized for human cell expression, AP_000144 |
USD 649.00 |
|
VC100408 | Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus D], codon optimized for human cell expression, AP_000145 |
USD 503.00 |
|
VC100409 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus D], codon optimized for human cell expression, AP_000146 |
USD 577.00 |
|
VC100410 | Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus D], codon optimized for human cell expression, AP_000147 |
USD 529.00 |
|
VC100411 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus D], codon optimized for human cell expression, AP_000148 |
USD 165.00 |
|
VC100412 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus D], codon optimized for human cell expression, AP_000149 |
USD 330.00 |
|
VC100413 | Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus D], codon optimized for human cell expression, AP_000150 |
USD 165.00 |
|
VC100415 | Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus D], codon optimized for human cell expression, AP_000152 |
USD 165.00 |
|
VC100416 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-gamma1 [Human adenovirus D], codon optimized for human cell expression, AP_000153 |
USD 330.00 |
|
VC100417 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus D], codon optimized for human cell expression, AP_000154 |
USD 165.00 |
|
VC100418 | Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus D], codon optimized for human cell expression, AP_000155 |
USD 165.00 |
|
VC100419 | Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus D], codon optimized for human cell expression, AP_000156 |
USD 165.00 |
|
VC100420 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus D], codon optimized for human cell expression, AP_000157 |
USD 503.00 |
|
VC100421 | Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus D], codon optimized for human cell expression, AP_000158 |
USD 330.00 |
|
VC100422 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus D], codon optimized for human cell expression, AP_000159 |
USD 165.00 |
|
VC100423 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus D], codon optimized for human cell expression, AP_000160 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review