Vegfa (NM_001287111) Rat Tagged ORF Clone

CAT#: RR216443

  • TrueORF®

Vegfa (myc-DDK-tagged) - Rat vascular endothelial growth factor A (Vegfa), transcript variant 6


  "NM_001287111" in other vectors (1)

Reconstitution Protocol

USD 503.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Vegfa"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Vegfa
Synonyms Vegf; VEGF-A; VEGF111; VEGF164; VPF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR216443 representing NM_001287111
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

CTGACGGACAGACAGACAGACACCGCCCCCAGCCCCAGCGCCCACCTCCTCGCCGGCGGGCAGCCGACGG
TGGACGCGGCGGCGAGCCGCGAGCAGGAGCCGAAGCCCGCGCCCGGAGGCGGGGTGGAGGGGGTCGGGGC
TCGCGGGATTGCACGGAAACTTTTCGTCCAACTTCTGGGCTCTTCTCTCTCCGGAGTAGCCGTGGTCTGC
GCCGCAGGAGGCAAACCGATCGGAGCTGGGAGAAGTGCTAGCTCGGGCCTGGAGAAGCCGGGGCCCGAGA
AGAGAGGGGAGAAAGAGAAGGAAGAGGAGAGGGGGCCGCAGTGGGCGCTCGGCTCTCGGGAGCCGGGCTC
ATGGACGGGTGAGGCGGCGGTGTGCGCAGACAGTGCTCCAGCCGCGCGCGCGCCCCAGGCCCCGGCCCGG
GCCTCGGTTCCAGAAGGGAGAGGAGCCCGCCAAGGCGCGCAAGAGAGCGGGCTGCCTCGCAGTCCGAGCC
GGAGAGGGAGCGCGAGCCGCGCCGGCCCCGGACGGGCCTCTGAAACCATGAACTTTCTGCTCTCTTGGGT
GCACTGGACCCTGGCTTTACTGCTGTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCACGACAGAA
GGGGAGCAGAAAGCCCATGAAGTGGTGAAGTTCATGGACGTCTACCAGCGCAGCTATTGCCGTCCAATTG
AGACCCTGGTGGACATCTTCCAGGAGTACCCCGATGAGATAGAGTATATCTTCAAGCCGTCCTGTGTGCC
CCTAATGCGGTGTGCGGGCTGCTGCAATGATGAAGCCCTGGAGTGCGTGCCCACGTCGGAGAGCAACGTC
ACTATGCAGATCATGCGGATCAAACCTCACCAAAGCCAGCACATAGGAGAGATGAGCTTCCTGCAGCATA
GCAGATGTGAATGCAGACCAAAGAAAGATAGAACAAAGCCAGAAAAAAAATCAGTTCGAGGAAAGGGAAA
GGGTCAAAAACGAAAGCGCAAGAAATCCCGGTTTAAATCCTGGAGCGTATGTGACAAGCCAAGGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR216443 representing NM_001287111
Red=Cloning site Green=Tags(s)

LTDRQTDTAPSPSAHLLAGGQPTVDAAASREQEPKPAPGGGVEGVGARGIARKLFVQLLGSSLSGVAVVC
AAGGKPIGAGRSASSGLEKPGPEKRGEKEKEEERGPQWALGSREPGSWTGEAAVCADSAPAARAPQAPAR
ASVPEGRGARQGAQESGLPRSPSRRGSASRAGPGRASETMNFLLSWVHWTLALLLYLHHAKWSQAAPTTE
GEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNV
TMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVCDKPRR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001287111
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001287111.1, NP_001274040.1
RefSeq Size 3414 bp
RefSeq ORF 1050 bp
Locus ID 83785
UniProt ID P16612
Cytogenetics 9q12
MW 37.8 kDa
Gene Summary This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.