Stk11 (NM_001108069) Rat Tagged ORF Clone

CAT#: RR208420

  • TrueORF®

Stk11 (Myc-DDK-tagged ORF) - Rat serine/threonine kinase 11 (Stk11), (10 ug)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001108069" in other vectors (3)

Reconstitution Protocol

USD 503.00

4 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Stk11"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Stk11
Synonyms Lkb1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR208420 representing NM_001108069
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGGCTGACCCCCAGCCGTTGGGCCTGTTCCCCGAGGGCGAGCTAATGTCGGTGGGCATGGACA
CCTTCATCCACCGCATCGACTCCACCGAGGTGATCTACCAGCCGCGCCGCAAGCGCGCCAAGCTCATCGG
CAAGTACCTGATGGGGGACCTGCTCGGGGAGGGCTCGTACGGCAAGGTGAAGGAGGTGCTGGACTCCGAG
ACCTTATGCCGCAGGGCGGTCAAGATCCTCAAGAAGAAAAAGCTGCGCAGGATCCCCAATGGCGAGGCCA
ACGTCAAGAAGGAGATCCAGCTGCTGCGGCGGCTGCGGCATCGGAATGTGATCCAGCTTGTGGATGTGCT
GTACAATGAGGAGAAGCAGAAGATGTATATGGTGATGGAGTACTGCGTGTGTGGCATGCAGGAGATGCTG
GACAGTGTGCCAGAGAAGCGCTTCCCCGTGTGCCAAGCTCATGGGTACTTCCGCCAGCTGATTGACGGCC
TGGAGTACCTACACAGCCAGGGCATTGTTCACAAGGACATCAAGCCGGGCAACCTGCTCCTCACCACCAA
TGGCACACTCAAGATCTCCGACCTCGGTGTTGCCGAGGCCTTGCACCCTTTCGCTGTGGATGACACCTGC
CGGACCAGCCAGGGCTCCCCAGCCTTCCAGCCTCCAGAGATTGCCAATGGACTGGACACCTTTTCAGGTT
TCAAGGTGGACATCTGGTCAGCTGGGGTCACACTCTACAACATCACCACGGGCCTGTACCCATTTGAGGG
GGACAATATCTACAAGCTCTTTGAGAACATCGGGAGAGGGGACTTCACCATCCCTTGTGACTGCGCTCCA
CCACTCTCTGACCTACTCCGAGGGATGTTGGAGTACGAGCCAGCCAAGAGGTTCTCCATCCGACAGATTA
GACAGCACAGCTGGTTCCGGAAGAAACACCCGCTGGCCGAGGCTCTTGTGCCTATCCCCCCAAGTCCAGA
CACTAAGGACCGCTGGCGCAGCATGACCGTAGTGCCCTACCTGGAGGACCTGCATGGCCGTGCAGAGGAG
GAGGAGGACGAGGACTTGTTTGACATTGAGGACGGCATCATCTATACCCAGGACTTCACAGTGCCTGGAC
AGGTCCTGGAAGAGGAAGTGGGTCAGAATGGACAGAGCCACAGCCTGCCCAAGGCTGTTTGTGTGAATGG
CACAGAGCCCCAGCTCAGCAGCAAGGTGAAGCCAGAAGGCCGGCCTGGCGCTGCCAACCCTGCACGCAAG
GTGTGCTCCAGCAACAAGATCCGCCGGCTCTCGGCCTGCAAGCAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR208420 representing NM_001108069
Red=Cloning site Green=Tags(s)

MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE
TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML
DSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTC
RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAP
PLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEE
EEDEDLFDIEDGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARK
VCSSNKIRRLSACKQQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001108069
ORF Size 1308 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001108069.1, NP_001101539.1
RefSeq Size 3120 bp
RefSeq ORF 1311 bp
Locus ID 314621
UniProt ID A0A0H2UI02
Cytogenetics 7q11
MW 49.2 kDa
Gene Summary Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2 and thereby regulates processes including: inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, and B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neuron polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear and phosphorylation may be indirect and mediated by downstream STK11/LKB1 kinase NUAK1. Also acts as a mediator of p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to the mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways. Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with NUAK1, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.