CNOT8 (NM_001301083) Human Tagged ORF Clone

CAT#: RG236389

  • TrueORF®

CNOT8 (tGFP-tagged) - Human CCR4-NOT transcription complex, subunit 8 (CNOT8), transcript variant 8

ORF Plasmid: DDK tGFP


  "NM_001301083" in other vectors (2)

Reconstitution Protocol

USD 530.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit polyclonal CNOT8 Antibody (C-term)
    • 400 ul

USD 580.00

Other products for "CNOT8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CNOT8
Synonyms CAF1; Caf1b; CALIF; hCAF1; POP2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG236389 representing NM_001301083.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTACTCCCAGGATTCCATAGATCTCCTTGCTAACTCAGGACTACAGTTTCAGAAGCATGAAGAGGAA
GGGATTGACACACTGCACTTTGCAGAGCTGCTTATGACATCAGGAGTGGTTCTCTGTGACAATGTCAAA
TGGCTTTCATTTCATAGTGGCTATGATTTTGGCTATATGGTAAAGTTGCTTACAGATTCTCGTTTGCCA
GAAGAGGAACATGAATTCTTTCATATTCTGAACCTTTTCTTCCCATCCATTTATGATGTGAAATACCTG
ATGAAGAGCTGCAAAAATCTTAAGGGAGGTCTTCAGGAAGTTGCTGATCAGTTGGATTTGCAGAGGATT
GGAAGGCAGCACCAGGCAGGCTCAGACTCACTGCTGACAGGAATGGCTTTCTTTAGGATGAAAGAGTTG
TTTTTTGAGGACAGCATTGATGATGCCAAGTACTGTGGGCGGCTCTATGGCTTAGGCACAGGAGTGGCC
CAGAAGCAGAATGAGGATGTGGACTCTGCCCAGGAGAAGATGAGCATCCTGGCGATTATCAACAACATG
CAGCAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG236389
Blue=ORF Red=Cloning site Green=Tag(s)

MYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLP
EEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKEL
FFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301083
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001301083.1, NP_001288012.1
RefSeq Size 2265 bp
RefSeq ORF 561 bp
Locus ID 9337
UniProt ID Q9UFF9
Cytogenetics 5q33.2
Protein Families Transcription Factors
Protein Pathways RNA degradation
MW 21.7 kDa
Gene Summary Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT7. Catalytic component of the CCR4-NOT complex which is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.