Fucose mutarotase (FUOM) (NM_001301827) Human Tagged ORF Clone

CAT#: RG235913

  • TrueORF®

FUOM (tGFP-tagged) - Human fucose mutarotase (FUOM), transcript variant 3

ORF Plasmid: DDK tGFP


  "NM_001301827" in other vectors (2)

Reconstitution Protocol

USD 365.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Fucose mutarotase"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol Fucose mutarotase
Synonyms C10orf125; FucM; FUCU
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG235913 representing NM_001301827.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGTGGCGCTGAAGGGTGTCCCCGCACTGCTGTCCCCCGAGCTGCTCTACGCGCTGGCGCGGATGGGG
CACGGGGACGAGATCGGCCTGGGCATCCCGCAGCTCCTGGAGGCCGTGCTGAAGCTGCTGCCCCTGGAC
ACCTATGTGGAGAGTCCGGCTGCAGTCATGGAGCTGGTGCCCAGCGACAAGGAGAGGGGCCTGCAGACC
CCAGTGTGGACGGAGTACGAGTCCATCCTACGCAGGGCCGGCTGTGTGAGAGCCCTGGCAAAGATAGAG
AGGTTTGAGTTTTATGAACGGGCTAAGAAGGCTTTTGCTGTTGTGGCAACGGGGGAGACGGCCCTCTAC
GGAAACCTCATCCTCAGGAAGGGGGTGCTTGCCCTCAACCCCCTGCTG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG235913
Blue=ORF Red=Cloning site Green=Tag(s)

MVALKGVPALLSPELLYALARMGHGDEIGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQT
PVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301827
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001301827.2
RefSeq Size 630 bp
RefSeq ORF 396 bp
Locus ID 282969
UniProt ID A2VDF0
Cytogenetics 10q26.3
MW 14.8 kDa
Gene Summary Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.