Clathrin light chain (CLTA) (NM_001076677) Human Tagged ORF Clone

CAT#: RG219088

  • TrueORF®

CLTA (tGFP-tagged) - Human clathrin, light chain A (CLTA), transcript variant 3

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001076677" in other vectors (4)

Reconstitution Protocol

USD 530.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


CLTA mouse monoclonal antibody,clone OTI2D12
    • 100 ul

USD 447.00

Other products for "Clathrin light chain"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol Clathrin light chain
Synonyms LCA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG219088 representing NM_001076677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGCTGGATCCGTTCGGCGCCCCTGCCGGCGCCCCTGGCGGTCCCGCGCTGGGGAACGGAGTGG
CCGGCGCCGGCGAAGAAGACCCGGCTGCGGCCTTCTTGGCGCAGCAAGAGAGCGAGATTGCGGGCATCGA
GAACGACGAGGCCTTCGCCATCCTGGACGGCGGCGCCCCCGGGCCCCAGCCGCACGGCGAGCCGCCGGGG
GGTCCGGATGCTGTTGATGGAGTAATGAATGGTGAATACTACCAGGAAAGTAATGGTCCAACAGACAGTT
ATGCAGCTATTTCACAAGTGGATCGATTGCAGTCAGAGCCTGAAAGTATCCGTAAATGGAGAGAAGAACA
AATGGAACGCTTGGAAGCCCTTGATGCCAATTCTCGGAAGCAAGAAGCAGAGTGGAAAGAAAAGGCAATA
AAGGAGCTAGAAGAATGGTATGCAAGACAGGACGAGCAGCTACAGAAAACAAAAGCAAACAACAGGGTGG
CAGATGAAGCTTTCTACAAACAACCCTTCGCTGACGTGATTGGTTATGTGGCAGCAGAAGAAGCCTTTGT
AAATGACATTGACGAGTCGTCCCCAGGCACTGAGTGGGAACGGGTGGCCCGGCTGTGTGACTTTAACCCC
AAGTCTAGCAAGCAGGCCAAAGATGTCTCCCGCATGCGCTCAGTCCTCATCTCCCTCAAGCAGGCCCCGC
TGGTGCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG219088 representing NM_001076677
Red=Cloning site Green=Tags(s)

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG
GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI
KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVAAEEAFVNDIDESSPGTEWERVARLCDFNP
KSSKQAKDVSRMRSVLISLKQAPLVH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001076677
ORF Size 708 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001076677.3
RefSeq Size 1210 bp
RefSeq ORF 711 bp
Locus ID 1211
UniProt ID P09496
Cytogenetics 9p13.3
Protein Pathways Endocytosis, Huntington's disease, Lysosome
Gene Summary Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, May 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.