SCD5 (NM_024906) Human Tagged ORF Clone

CAT#: RG216929

  • TrueORF®

SCD5 (tGFP-tagged) - Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_024906" in other vectors (4)

Reconstitution Protocol

USD 500.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


SCD5 Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "SCD5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SCD5
Synonyms ACOD4; FADS4; HSCD5; SCD2; SCD4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG216929 representing NM_024906
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGGCCCGGCCACCGACGCGGGGAAGATCCCTTTCTGCGACGCCAAGGAAGAAATCCGTGCCGGGC
TCGAAAGCTCTGAGGGCGGCGGCGGCCCGGAGAGGCCAGGCGCGCGCGGGCAGCGGCAGAACATCGTCTG
GAGGAATGTCGTCCTGATGAGCTTGCTCCACTTGGGGGCCGTGTACTCCCTGGTGCTCATCCCCAAAGCC
AAGCCACTCACTCTGCTCTGGGCCTACTTCTGCCTCCTCCTGGCCGCTCTGGGTGTGACAGCTGGTGCCC
ATCGCTTGTGGAGCCACAGGTCCTACCGGGCCAAGCTGCCTCTGAGGATATTTCTGGCTGTCGCCAACTC
CATGGCTTTCCAGAATGACATCTTCGAGCGGTCCAGGGACCACCGAGCCCACCACAAGTACTCAGAGACG
GATGCTGACCCCCACAATGCCCGCCGGGGCTTCTTCTTCTCCCATATTGGGTGGCTGTTTGTTCGCAAGC
ATCGAGATGTTATTGAGAAGGGGAGAAAGCTTGACGTCACTGACCTGCTTGCTGATCCTGTGGTCCGGAT
CCAGAGAAATACACAGCACATCCAGAAAGAAGGAAGAGCTCTCAATCAAGAGGCAGCGTGTGAGATGCTT
CGTGAGTGGCATCAAGGGCATATATTGAAAGTCACCCTTCCCGGATTACACATTTTAGCTTTGTTACATA
CTCATTGTAACCACTCCGAAAAGTGCTGCTTGATGCTGCGTGCTCTTTCTGTGTCCCTGGAGGTATTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216929 representing NM_024906
Red=Cloning site Green=Tags(s)

MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKA
KPLTLLWAYFCLLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFERSRDHRAHHKYSET
DADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRNTQHIQKEGRALNQEAACEML
REWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024906
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024906.1, NP_079182.1
RefSeq Size 2021 bp
RefSeq ORF 771 bp
Locus ID 79966
UniProt ID Q86SK9
Cytogenetics 4q21.22
Domains FA_desaturase
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids, PPAR signaling pathway
Gene Summary Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an integral membrane protein of the endoplasmic reticulum that catalyzes the formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energy metabolism with a role in obesity and dislipidemia. Four SCD isoforms, Scd1 through Scd4, have been identified in mouse. In contrast, only 2 SCD isoforms, SCD1 (MIM 604031) and SCD5, have been identified in human. SCD1 shares about 85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shares limited homology with the rodent SCDs and appears to be unique to primates (Wang et al., 2005 [PubMed 15907797]).[supplied by OMIM, Mar 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.