ZAP70 (NM_207519) Human Tagged ORF Clone
CAT#: RG206710
- TrueORF®
ZAP70 (tGFP-tagged) - Human zeta-chain (TCR) associated protein kinase 70kDa (ZAP70), transcript variant 2
ORF Plasmid: DDK
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_207519" in other vectors (4)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | ZAP70 |
Synonyms | ADMIO2; IMD48; SRK; STCD; STD; TZK; ZAP-70 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG206710 representing NM_207519
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGCTTGGGGCCGCGCTGGAAGGGCGAGGCCCTGGAGCAGGCCATCATCAGCCAGGCCCCGCAGGTGG AGAAGCTCATTGCTACGACGGCCCACGAGCGGATGCCCTGGTACCACAGCAGCCTG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG206710 representing NM_207519
Red=Cloning site Green=Tags(s) MRLGPRWKGEALEQAIISQAPQVEKLIATTAHERMPWYHSSL TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_207519 |
ORF Size | 936 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_207519.1, NP_997402.1 |
RefSeq Size | 1468 bp |
RefSeq ORF | 939 bp |
Locus ID | 7535 |
UniProt ID | P43403 |
Cytogenetics | 2q11.2 |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Natural killer cell mediated cytotoxicity, Primary immunodeficiency, T cell receptor signaling pathway |
Gene Summary | This gene encodes an enzyme belonging to the protein tyrosine kinase family, and it plays a role in T-cell development and lymphocyte activation. This enzyme, which is phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation, functions in the initial step of TCR-mediated signal transduction in combination with the Src family kinases, Lck and Fyn. This enzyme is also essential for thymocyte development. Mutations in this gene cause selective T-cell defect, a severe combined immunodeficiency disease characterized by a selective absence of CD8-positive T-cells. Two transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206710 | ZAP70 (Myc-DDK-tagged)-Human zeta-chain (TCR) associated protein kinase 70kDa (ZAP70), transcript variant 2 |
USD 450.00 |
|
RC206710L3 | Lenti-ORF clone of ZAP70 (Myc-DDK-tagged)-Human zeta-chain (TCR) associated protein kinase 70kDa (ZAP70), transcript variant 2 |
USD 750.00 |
|
RC206710L4 | Lenti-ORF clone of ZAP70 (mGFP-tagged)-Human zeta-chain (TCR) associated protein kinase 70kDa (ZAP70), transcript variant 2 |
USD 750.00 |
|
SC308606 | ZAP70 (untagged)-Human zeta-chain (TCR) associated protein kinase 70kDa (ZAP70), transcript variant 2 |
USD 480.00 |
{0} Product Review(s)
Be the first one to submit a review