JWA (ARL6IP5) (NM_006407) Human Tagged ORF Clone

CAT#: RG205000

  • TrueORF®

ARL6IP5 (tGFP-tagged) - Human ADP-ribosylation-like factor 6 interacting protein 5 (ARL6IP5)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_006407" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Goat Polyclonal Antibody against ARL6IP5
    • 100 ug

USD 520.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol JWA
Synonyms addicsin; DERP11; GTRAP3-18; hp22; HSPC127; jmx; JWA; PRAF3; Yip6b
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG205000 representing NM_006407
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTTAATATCGCCCCACTCCGCGCCTGGGACGATTTCTTCCCGGGTTCCGATCGCTTTGCCCGGC
CGGACTTCAGGGACATTTCCAAATGGAACAACCGCGTAGTGAGCAACCTGCTCTATTACCAGACCAACTA
CCTGGTGGTGGCTGCCATGATGATTTCCATTGTGGGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGA
ATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCCCACAATAAAGACGTCCTTCGCCGGATGA
AGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCCATGTTTGG
AGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGA
CTTCGGAACCTCAAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCA
TTGTCCTGGATGCCCTAGAACAGCAGGAAGAAGGCATCAACAGACTCACTGACTATATCAGCAAAGTGAA
GGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205000 representing NM_006407
Red=Cloning site Green=Tags(s)

MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGG
IVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLR
LRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006407
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006407.4
RefSeq Size 2135 bp
RefSeq ORF 567 bp
Locus ID 10550
UniProt ID O75915
Cytogenetics 3p14.1
Protein Families Transmembrane
Gene Summary Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.