AIPL1 (NM_001285402) Human Tagged ORF Clone

CAT#: RC237605

  • TrueORF®

AIPL1 (myc-DDK-tagged) - Human aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 7

ORF Plasmid: DDK tGFP


  "NM_001285402" in other vectors (2)

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


AIPL1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)
    • 100 ul

USD 447.00

Other products for "AIPL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AIPL1
Synonyms AIPL2; LCA4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC237605 representing NM_001285402
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAATGTGATGAGGAGCGGACAGTCATTGACGACAGTCGGCAGGTGGGCCAGCCCATGCACATCATCA
TCGGAAACATGTTCAAGCTCGAGGTCTGGGAGATCCTGCTTACCTCCATGCGGGTGCACGAGGTGGCCGA
GTTCTGGTGCGACACCATCCACACGGGGGTCTACCCCATCCTATCCCGGAGCCTGAGGCAGATGGCCCAG
GGCAAGGACCCCACAGAGTGGCACGTGCACACGTGCGGGCTGGCCAACATGTTCGCCTACCACACGCTGG
GCTACGAGGACCTGGACGAGCTGCAGAAGGAGCCTCAGCCTCTGGTCTTTGTGATCGAGCTGCTGCAGGT
TGATGCCCCGAGTGATTACCAGAGGGAGACCTGGAACCTGAGCAATCATGAGAAGATGAAGGCGGTGCCC
GTCCTCCACGGAGAGGGAAATCGGCTCTTCAAGCTGGGCCGCTACGAGGAGGCCTCTTCCAAGTACCAGG
AGGCCATCATCTGCCTAAGGAACCTGCAGACCAAGGAGAAGCCATGGGAGGTGCAGTGGCTGAAGCTGGA
GAAGATGATCAATACTCTGATCCTCAACTACTGCCAGTGCCTGCTGAAGAAGGAGGAGTACTATGAGGTG
CTGGAGCACACCAGTGATATTCTCCGGCACCACCCAGGCATCGTGAAGGCCTACTACGTGCGTGCCCGGG
CTCACGCAGAGGTGTGGAATGAGGCCGAGGCCAAGGCGGACCTCCAGAAAGTGCTGGAGCTGGAGCCGTC
CATGCAGAAGGCGGTGCGCAGGGAGCTGAGGCTGCTGGAGAACCGCATGGCGGAGAAGCAGGAGGAGGAG
CGGCTGCGCTGCCGGAACATGCTGAGCCAGGGTGCCACGCAGCCTCCCGCAGAGCCACCCACAGAGCCAC
CCGCACAGTCATCCACAGAGCCACCTGCAGAGCCACCCACAGCACCATCTGCAGAGCTGTCCGCAGGGCC
CCCTGCAGAGCCAGCCACAGAGCCACCCCCGTCCCCAGGGCACTCGCTGCAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC237605 representing NM_001285402
Red=Cloning site Green=Tags(s)

MKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQ
GKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVP
VLHGEGNRLFKLGRYEEASSKYQEAIICLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEV
LEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEE
RLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001285402
ORF Size 1035 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001285402.2
RefSeq Size 2964 bp
RefSeq ORF 1038 bp
Locus ID 23746
Cytogenetics 17p13.2
Protein Families Druggable Genome
MW 40.1 kDa
Gene Summary Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.