TID1 (DNAJA3) (NM_001286516) Human Tagged ORF Clone

CAT#: RC237306

  • TrueORF®

DNAJA3 (myc-DDK-tagged) - Human DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 3

ORF Plasmid: DDK tGFP


  "NM_001286516" in other vectors (2)

Reconstitution Protocol

USD 480.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-DNAJA3 Antibody
    • 100 ul

USD 380.00

Other products for "TID1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TID1
Synonyms HCA57; hTID-1; TID1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC237306 representing NM_001286516
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAGCCGCAAGCTGAGCGTCCCCGCCTTTGCGTCTTCCCTGACCTCTTGCGGCCCCCGAGCGCTG
CTGACATTGAGACCTGGTGTCAGCCTTACAGGAAGATCTTTGGCGAGTTCTCATCCTCTTCATTTGGAGA
TTTCCAGACCGTGTTTGATCAGCCTCAGGAATACTTCATGGAGTTGACATTCAATCAAGCTGCAAAGGGG
GTCAACAAGGAGTTCACCGTGAACATCATGGACACGTGTGAGCGCTGCAACGGCAAGGGGAACGAGCCCG
GCACCAAGGTGCAGCATTGCCACTACTGTGGCGGCTCCGGCATGGAAACCATCAACACAGGCCCTTTTGT
GATGCGTTCCACGTGTAGGAGATGTGGTGGCCGCGGCTCCATCATCATATCGCCCTGTGTGGTCTGCAGG
GGAGCAGGACAAGCCAAGCAGAAAAAGCGAGTGATGATCCCTGTGCCTGCAGGAGTCGAGGATGGCCAGA
CCGTGAGGATGCCTGTGGGAAAAAGGGAAATTTTCATTACGTTCAGGGTGCAGAAAAGCCCTGTGTTCCG
GAGGGACGGCGCAGACATCCACTCCGACCTCTTTATTTCTATAGCTCAGGCTCTTCTTGGGGGTACAGCC
AGAGCCCAGGGCCTGTACGAGACGATCAACGTGACGATCCCCCCTGGGACTCAGACAGACCAGAAGATTC
GGATGGGTGGGAAAGGCATCCCCCGGATTAACAGCTACGGCTACGGAGACCACTACATCCACATCAAGAT
ACGAGTTCCAAAGAGGCTAACGAGCCGGCAGCAGAGCCTGATCCTGAGCTACGCCGAGGACGAGACAGAT
GTGGAGGGGACGGTGAACGGCGTCACCCTCACCAGCTCTGGAAAAAGATCCACTGGAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC237306 representing NM_001286516
Red=Cloning site Green=Tags(s)

MAEPQAERPRLCVFPDLLRPPSAADIETWCQPYRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKG
VNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCR
GAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTA
RAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETD
VEGTVNGVTLTSSGKRSTGN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001286516
ORF Size 900 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001286516.1, NP_001273445.1
RefSeq Size 2314 bp
RefSeq ORF 903 bp
Locus ID 9093
UniProt ID Q96EY1
Cytogenetics 16p13.3
MW 33.5 kDa
Gene Summary This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized to mitochondria and mediates several cellular processes including proliferation, survival and apoptotic signal transduction. The encoded protein also plays a critical role in tumor suppression through interactions with oncogenic proteins including ErbB2 and the p53 tumor suppressor protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.