RNF146 (NM_001242850) Human Tagged ORF Clone

CAT#: RC233874

  • TrueORF®

RNF146 (Myc-DDK tagged) - Homo sapiens ring finger protein 146 (RNF146), transcript variant 9

ORF Plasmid: DDK tGFP


  "NM_001242850" in other vectors (2)

Reconstitution Protocol

USD 503.00

5 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "RNF146"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNF146
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC233874 representing NM_001242850
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCTGGCTGTGGTGAAATTGATCATTCAATAAACATGCTTCCTACAAACAGGAAAGCGAACGAGT
CCTGTTCTAATACTGCACCTTCTTTAACCGTCCCTGAATGTGCCATTTGTCTGCAAACATGTGTTCATCC
AGTCAGTCTGCCCTGTAAGCACGTTTTCTGCTATCTATGTGTAAAAGGAGCTTCATGGCTTGGAAAGCGG
TGTGCTCTTTGTCGACAAGAAATTCCCGAGGATTTCCTTGACAAGCCAACCTTGTTGTCACCAGAAGAAC
TCAAGGCAGCAAGTAGAGGAAATGGTGAATATGCATGGTATTATGAAGGAAGAAATGGGTGGTGGCAGTA
CGATGAGCGCACTAGTAGAGAGCTGGAAGATGCTTTTTCCAAAGGTAAAAAGAACACTGAAATGTTAATT
GCTGGCTTTCTGTATGTCGCTGATCTTGAAAACATGGTTCAATATAGGAGAAATGAACATGGACGTCGCA
GGAAGATTAAGCGAGATATAATAGATATACCAAAGAAGGGAGTAGCTGGACTTAGGCTAGACTGTGATGC
TAATACCGTAAACCTAGCAAGAGAGAGCTCTGCTGACGGAGCGGACAGTGTATCAGCACAGAGTGGAGCT
TCTGTTCAGCCCCTAGTGTCTTCTGTAAGGCCCCTAACATCAGTAGATGGTCAGTTAACAAGCCCTGCAA
CACCATCCCCTGATGCAAGCACTTCTCTGGAAGACTCTTTTGCTCATTTACAACTCAGTGGAGACAACAC
AGCTGAAAGGAGTCATAGGGGAGAAGGAGAAGAAGATCATGAATCACCATCTTCAGGCAGGGTACCAGCA
CCAGACACCTCCATTGAAGAAACTGAATCAGATGCCAGTAGTGATAGTGAGGATGTATCTGCAGTTGTTG
CACAGCACTCCTTGACCCAACAGAGACTTTTGGTTTCTAATGCAAACCAGACAGTACCCGATCGATCAGA
TCGATCGGGAACTGATCGATCAGTAGCAGGGGGTGGAACAGTGAGTGTCAGTGTCAGATCTAGAAGGCCT
GATGGACAGTGCACAGTAACTGAAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC233874 representing NM_001242850
Red=Cloning site Green=Tags(s)

MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKR
CALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLI
AGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGA
SVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPA
PDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRP
DGQCTVTEV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001242850
ORF Size 1077 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001242850.2
RefSeq Size 2163 bp
RefSeq ORF 1080 bp
Locus ID 81847
UniProt ID Q9NTX7
Cytogenetics 6q22.33
Protein Families Druggable Genome
MW 39.4 kDa
Gene Summary E3 ubiquitin-protein ligase that specifically binds poly-ADP-ribosylated (PARsylated) proteins and mediates their ubiquitination and subsequent degradation. May regulate many important biological processes, such as cell survival and DNA damage response. Acts as an activator of the Wnt signaling pathway by mediating the ubiquitination of PARsylated AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex. Acts in cooperation with tankyrase proteins (TNKS and TNKS2), which mediate PARsylation of target proteins AXIN1, AXIN2, BLZF1, CASC3, TNKS and TNKS2. Recognizes and binds tankyrase-dependent PARsylated proteins via its WWE domain and mediates their ubiquitination, leading to their degradation. Different ubiquitin linkage types have been observed: TNKS2 undergoes ubiquitination at 'Lys-48' and 'Lys-63', while AXIN1 is only ubiquitinated at 'Lys-48'. May regulate TNKS and TNKS2 subcellular location, preventing aggregation at a centrosomal location. Neuroprotective protein. Protects the brain against N-methyl-D-aspartate (NMDA) receptor-mediated glutamate excitotoxicity and ischemia, by interfering with PAR-induced cell death, called parthanatos. Prevents nuclear translocation of AIFM1 in a PAR-binding dependent manner. Does not affect PARP1 activation (By similarity). Protects against cell death induced by DNA damaging agents, such as N-methyl-N-nitro-N-nitrosoguanidine (MNNG) and rescues cells from G1 arrest. Promotes cell survival after gamma-irradiation. Facilitates DNA repair.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.