DAZAP2 (NM_001136268) Human Tagged ORF Clone
CAT#: RC227571
- TrueORF®
DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_001136268" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | DAZAP2 |
Synonyms | PRTB |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC227571 representing NM_001136268
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACAGCAAAGGTCAATATCCAACACAGCCAACCTACCCTGTGCAGCCTCCTGGGAATCCAGTATACC CTCAGACCTTGCATCTTCCTCAGGCTCCACCCTATACCGATGCTCCACCTGCCTACTCAGAGCCTCCACC TCCTGGATGCCCTCCCAATGCTGCTCAGCTTGCAGTCATGCAGGGAGCCAACGTCCTCGTAACTCAGCGG AAGGGGAACTTCTTCATGGGTGGTTCAGATGGTGGCTACACCATCTGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC227571 representing NM_001136268
Red=Cloning site Green=Tags(s) MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSEPPPPGCPPNAAQLAVMQGANVLVTQR KGNFFMGGSDGGYTIW myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001136268 |
ORF Size | 258 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001136268.2 |
RefSeq ORF | 261 bp |
Locus ID | 9802 |
UniProt ID | Q15038 |
Cytogenetics | 12q13.13 |
MW | 9 kDa |
Gene Summary | This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC227571L3 | Lenti-ORF clone of DAZAP2 (Myc-DDK-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5 |
USD 465.00 |
|
RC227571L4 | Lenti-ORF clone of DAZAP2 (mGFP-tagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5 |
USD 465.00 |
|
RG227571 | DAZAP2 (tGFP-tagged) - Human DAZ associated protein 2 (DAZAP2), transcript variant 5 |
USD 365.00 |
|
SC325440 | DAZAP2 (untagged)-Human DAZ associated protein 2 (DAZAP2), transcript variant 5 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review