RFC5 (NM_001130112) Human Tagged ORF Clone

CAT#: RC225336

  • TrueORF®

RFC5 (Myc-DDK-tagged)-Human replication factor C (activator 1) 5, 36.5kDa (RFC5), transcript variant 4

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001130112" in other vectors (4)

Reconstitution Protocol

USD 503.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-RFC5 Antibody
    • 100 ul

USD 539.00

Other products for "RFC5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RFC5
Synonyms RFC36
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC225336 representing NM_001130112
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACCTCAGCACTCAAGCAGCAGGAGCAGCCCGCGGCGACCAAGATCAGGAACCTGCCCTGGGTTG
AAAAATACCGGCCACAGACCCTGAATGATCTCATTTCTCATCAGGACATTCTGAGTACCATTCAGAAGTT
TATCAATGAAGACCGACTGCCACACTTGCTTCTCTACGGTCCCCCAGGGACAGGCAAGACATCTACCATC
CTAGCCTGTGCGAAACAGCTATATAAAGACAAAGAATTTGGCTCCATGGTCTTGGAGCTGAATGCTTCAG
ATGACCGAGGAATAGACATCATTCGAGGACCGATCCTGAGCTTTGCTAGCACAAGGACAATATTTAAGAA
AGGCTTTAAGCTAGTGATCTTGGATGAAGCAGACGCCATGACTCAGGACGCCCAGAATGCCTTGAGAAGA
GTAATTGAGAAATTCACAGAAAATACCAGATTCTGCCTCATCTGTAACTATCTGTCAAAGATCATCCCTG
CCTTGCAGTCCCGCTGCACGAGGTTTCGGTTCGGTCCCCTGACTCCTGAACTCATGGTTCCCCGCCTGGA
ACATGTCGTGGAAGAAGAGAAAGTTGATATAAGTGAAGATGGAATGAAAGCACTAGTCACTCTTTCCAGT
GGAGACATGCGTAGGGCTCTGAACATTTTGCAGAGCACCAATATGGCCTTTGGGAAGGTGACAGAGGAGA
CTGTCTACACCTGCACCGGGCACCCGCTCAAGTCAGACATTGCCAACATCCTGGACTGGATGTTGAATCA
AGATTTCACCACAGCCTACAGAAATATTACAGAGTTGAAAACTCTGAAGGGGTTGGCACTGCATGATATC
CTGACAGAGATACACTTGTTTGTGCATAGAGTTGACTTTCCATCTTCAGTTCGAATACATTTATTGACCA
AAATGGCAGACATTGAGTACAGGCTTTCTGTTGGCACCAACGAGAAGATCCAGCTGAGCTCCCTCATTGC
TGCATTTCAAGTCACCAGAGACCTGATTGTTGCAGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC225336 representing NM_001130112
Red=Cloning site Green=Tags(s)

METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTI
LACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRR
VIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSS
GDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDI
LTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001130112
ORF Size 1023 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001130112.1, NM_001130112.2, NM_001130112.3, NP_001123584.1
RefSeq Size 2248 bp
RefSeq ORF 768 bp
Locus ID 5985
UniProt ID P40937
Cytogenetics 12q24.23
Protein Families Stem cell - Pluripotency
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
MW 38.5 kDa
Gene Summary This gene encodes the smallest subunit of the replication factor C complex, which consists of five distinct subunits (140, 40, 38, 37, and 36 kDa) and is required for DNA replication. This subunit interacts with the C-terminal region of proliferating cell nuclear antigen and is required to open and load proliferating cell nuclear antigen onto DNA during S phase. It is a member of the AAA+ (ATPases associated with various cellular activities) ATPase family and forms a core complex with the 38 and 40 kDa subunits that possesses DNA-dependent ATPase activity. A related pseudogene has been identified on chromosome 9. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.