BRCC36 (BRCC3) (NM_001018055) Human Tagged ORF Clone

CAT#: RC224289

BRCC3 (Myc-DDK-tagged)-Human BRCA1/BRCA2-containing complex, subunit 3 (BRCC3), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_001018055" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


BRCC3 mouse monoclonal antibody,clone OTI6G7
    • 100 ul

USD 447.00

Other products for "BRCC36"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BRCC36
Synonyms BRCC36; C6.1A; CXorf53
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224289 representing NM_001018055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGCAGGTGGTGCAGGCGGTGCAGGCGGTTCATCTCGAGTCTGACGCTTTCCTCGTTTGTCTCA
ACCACGCTCTGAGCACAGAGAAGGAGGAAGTAATGGGGCTGTGCATAGGGGAGTTGAACGATGATACAAG
GAGTGACTCCAAATTTGCATATACTGGAACTGAAATGCGCACAGTTGCTGAAAAGGTTGATGCCGTCAGA
ATTGTTCACATTCATTCTGTCATCATCTTACGACGTTCTGATAAGAGGAAGGACCGAGTAGAAATTTCTC
CAGAGCAGCTGTCTGCAGCTTCAACAGAGGCAGAGAGGTTGGCTGAACTGACAGGCCGCCCCATGAGAGT
TGTGGGCTGGTATCATTCCCATCCTCATATAACTGTTTGGCCTTCACATGTTGATGTTCGCACACAAGCC
ATGTACCAGATGATGGATCAAGGCTTTGTAGGACTTATTTTTTCCTGTTTCATAGAAGATAAGAACACAA
AGACTGGCCGGGTACTCTACACTTGCTTCCAATCCATACAGGCCCAAAAGAGTTCAGAGTATGAGAGAAT
CGAAATCCCAATCCATATTGTACCTCATGTCACTATCGGGAAAGTGTGCCTTGAATCAGCAGTAGAGCTG
CCCAAGATCCTGTGCCAGGAGGAGCAGGATGCGTATAGGAGGATCCACAGCCTTACACATCTGGACTCAG
TAACCAAGATCCATAATGGCTCAGTGTTTACCAAGAATCTGTGCAGTCAGATGTCGGCAGTCAGCGGGCC
TCTCCTACAGTGGTTGGAGGACAGACTGGAGCAAAACCAACAGCATTTGCAGGAATTACAACAAGAAAAG
GAAGAGCTTATGCAAGAACTTTCTTCTCTAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224289 representing NM_001018055
Red=Cloning site Green=Tags(s)

MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVR
IVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQA
MYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVEL
PKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEK
EELMQELSSLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001018055
ORF Size 873 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001018055.3
RefSeq Size 2839 bp
RefSeq ORF 876 bp
Locus ID 79184
UniProt ID P46736
Cytogenetics Xq28
Protein Families Druggable Genome, Protease
MW 33 kDa
Gene Summary This gene encodes a subunit of the BRCA1-BRCA2-containing complex (BRCC), which is an E3 ubiquitin ligase. This complex plays a role in the DNA damage response, where it is responsible for the stable accumulation of BRCA1 at DNA break sites. The component encoded by this gene can specifically cleave Lys 63-linked polyubiquitin chains, and it regulates the abundance of these polyubiquitin chains in chromatin. The loss of this gene results in abnormal angiogenesis and is associated with syndromic moyamoya, a cerebrovascular angiopathy. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 5. [provided by RefSeq, Jun 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.