MAP1LC3B2 (NM_001085481) Human Tagged ORF Clone
CAT#: RC223078
MAP1LC3B2 (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_001085481" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | MAP1LC3B2 |
Synonyms | ATG8G |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223078 representing NM_001085481
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGTCGGAGAAGACCTTCAAGCAGCGGCGCACCTTCGAACAAAGAGTAGAAGATGTCCGACTTATTC GAGAGCAGCATCCAACCAAAATCCCGGTGATAATAGAACGATACAAGGGTGAGAAGCAGCTTCCTGTTCT GGATAAAACAAAGTTCCTTGTACCTGACCATGTCAACATGAGTGAGCTCATCAAGATAATTAGAAGGCGC TTACAGCTCAATGCTAATCAGGCCTTCTTCCTGTTGGTGAACGGACACAGCATGGTCAGCGTCTCCACAC CAATCTCAGAGGTGTATGAGAGTGAGAAAGATGAAGATGGATTCCTGTACATGGTCTGTGCCTCCCAGGA GACGTTCGGGATGAAATTGTCAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223078 representing NM_001085481
Red=Cloning site Green=Tags(s) MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001085481 |
ORF Size | 375 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001085481.3 |
RefSeq Size | 832 bp |
RefSeq ORF | 378 bp |
Locus ID | 643246 |
UniProt ID | A6NCE7 |
Cytogenetics | 12q24.22 |
MW | 14.4 kDa |
Gene Summary | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223078L1 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2), Myc-DDK-tagged |
USD 525.00 |
|
RC223078L2 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2), mGFP tagged |
USD 525.00 |
|
RC223078L3 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2), Myc-DDK-tagged |
USD 525.00 |
|
RC223078L4 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2), mGFP tagged |
USD 525.00 |
|
RG223078 | MAP1LC3B2 (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2) |
USD 425.00 |
|
SC316124 | MAP1LC3B2 (untagged)-Human microtubule-associated protein 1 light chain 3 beta 2 (MAP1LC3B2) |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review