ZNF664 (NM_152437) Human Tagged ORF Clone

CAT#: RC220845

  • TrueORF®

ZNF664 (Myc-DDK-tagged)-Human zinc finger protein 664 (ZNF664), transcript variant 1. Note: ORF is codon optimized

ORF Plasmid: DDK tGFP

AAV Particle: DDK


  "NM_152437" in other vectors (2)

Reconstitution Protocol

USD 300.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-ZNF664 Antibody
    • 100 ul

USD 539.00

Other products for "ZNF664"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZNF664
Synonyms ZFOC1; ZNF176
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220845 ORF sequence, codon optimized.
Due to the complexity of NM_152437, the ORF clone is codon optimized for mammalian Expression.
The nucleotide sequence differs from the reference sequence, yet the amino acid sequence remains identical
.

Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTATAAATGCCCAATGTGCAGGGAATTCTTTAGTGAGAGGGCCGATCTGTTTATGCATCAAAAGA
TTCATACCGCTGAAAAGCCCCACAAGTGCGATAAATGCGACAAGGGATTCTTCCATATATCCGAATTGCA
TATCCACTGGCGGGATCACACCGGGGAAAAAGTGTACAAATGTGATGACTGCGGAAAGGACTTTTCCACC
ACAACCAAACTGAATAGGCATAAGAAGATTCACACAGTTGAGAAGCCCTACAAATGTTATGAGTGCGGCA
AGGCCTTTAACTGGTCATCCCACCTGCAGATTCACATGCGAGTGCATACTGGGGAGAAGCCTTACGTATG
TTCTGAGTGCGGGCGAGGCTTTAGCAATTCCAGCAACCTTTGCATGCACCAAAGAGTACACACTGGGGAG
AAACCCTTTAAGTGCGAAGAGTGTGGAAAGGCTTTCCGCCATACGAGTTCCCTGTGCATGCACCAGAGGG
TTCATACGGGAGAAAAGCCCTATAAGTGCTATGAATGTGGGAAAGCCTTTAGCCAAAGCAGTTCCCTCTG
CATACACCAGAGGGTGCATACAGGCGAAAAGCCATATCGCTGCTGTGGCTGCGGAAAAGCCTTCTCCCAA
AGCTCTTCACTGTGCATTCATCAAAGGGTCCACACGGGCGAGAAGCCGTTCAAATGTGACGAATGTGGGA
AGGCCTTCTCCCAGTCAACCTCCCTGTGTATTCACCAGAGAGTACATACAAAAGAGCGGAACCACTTGAA
AATATCCGTGATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220845 representing NM_152437
Red=Cloning site Green=Tags(s)

MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFST
TTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMHQRVHTGE
KPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQ
SSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152437
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152437.1, NM_152437.2, NP_689650.1
RefSeq Size 4312 bp
RefSeq ORF 786 bp
Locus ID 144348
UniProt ID Q8N3J9
Cytogenetics 12q24.31
Domains zf-C2H2
MW 30.3 kDa
Gene Summary May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.