TMEM91 (NM_001098821) Human Tagged ORF Clone

CAT#: RC218672

TMEM91 (Myc-DDK-tagged)-Human transmembrane protein 91 (TMEM91), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_001098821" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-TMEM91 Antibody
    • 100 ul

USD 539.00

Other products for "TMEM91"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMEM91
Synonyms DSPC3; IFITMD6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218672 representing NM_001098821
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGCCCTAGTCTTCGTGAGCTTCAACAGCCTCTGCTGGAGGGCACAGAATGTGAGACCCCTGCCC
AGAAGCCTGGCAGGCATGAGCTGGGGTCCCCCTTAAGAGAGATAGCCTTTGCCGAGTCCCTGAGGGGTTT
GCAGTTCCTGTCACCGCCTCTTCCCTCCGTGAGCGCTGGCCTGGGGGAACCAAGGCCCCCTGATGTTGAG
GACATGTCATCCAGTGACAGTGACTCGGACTGGGATGGAGGCAGCCGTCTTTCACCATTTCTACCCCACG
ACCACCTCGGCTTGGCTGTCTTCTCCATGCTGTGTTGTTTCTGGCCCGTTGGCATCGCTGCCTTCTGTCT
AGCCCAGAAGACCAACAAGGCTTGGGCCAAGGGGGACATCCAGGGGGCAGGGGCCGCCTCCCGCCGTGCC
TTCCTGCTGGGGGTCCTCGCCGTCGGGCTGGGCGTGTGCACGTATGCGGCTGCCCTGGTGACCCTGGCTG
CCTACCTTGCCTCCCGAGACCCGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218672 representing NM_001098821
Red=Cloning site Green=Tags(s)

MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVE
DMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRA
FLLGVLAVGLGVCTYAAALVTLAAYLASRDPP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001098821
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001098821.2
RefSeq Size 1091 bp
RefSeq ORF 519 bp
Locus ID 641649
UniProt ID Q6ZNR0
Cytogenetics 19q13.2
Protein Families Transmembrane
MW 18 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.