PSMA8 (NM_001025096) Human Tagged ORF Clone

CAT#: RC217826

  • TrueORF®

PSMA8 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 8 (PSMA8), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_001025096" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


PSMA8 Antibody - middle region
    • 100 ul

USD 539.00

Other products for "PSMA8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PSMA8
Synonyms PSMA7L
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217826 representing NM_001025096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCTCGATATGACAGGGCGATCACTGTCTTCTCCCCAGACGGACACCTTTTTCAAGTTGAATATG
CCCAGGAAGCGGTGAAGAAAGGATCCACCGCGGTCGGAATTCGAGGTACCAATATAGTTGTTCTTGGGGT
AGAAAAAAAATCTGTTGCCAAGCTTCAAGATGAAAGAACTGTGAGGAAAATTTGTGCCCTTGATGACCAT
GTCTGCATGGCTTTTGCAGGACTTACTGCTGATGCTAGAGTAGTAATAAACAGAGCCCGTGTGGAGTGCC
AGAGCCATAAGCTTACGGTTGAGGACCCAGTCACTGTAGAATACATAACTCGCTTCATAGCAACTTTAAA
GCAGAAATATACCCAAAGCAATGGACGAAGACCTTTTGGTATTTCTGCCTTAATTGTAGGTTTTGATGAT
GATGGTATCTCAAGATTGTATCAGACAGATCCTTCTGGTACTTATCATGCTTGGAAGGCAAATGCAATAG
GCCGAAGTGCTAAAACTGTTCGAGAATTTCTAGAAAAGAATTACACAGAAGATGCCATAGCAAGTGACAG
TGAAGCTATCAAGTTAGCAATAAAAGCTTTGCTAGAAGTTGTCCAGTCTGGTGGAAAAAACATTGAACTT
GCTATAATAAGAAGAAATCAACCTTTGAAGATGTTTAGTGCAAAAGAAGTTGAATTATATGTAACTGAAA
TAGAAAAGGAAAAGGAAGAAGCAGAGAAGAAAAAATCAAAGAAATCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217826 representing NM_001025096
Red=Cloning site Green=Tags(s)

MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDH
VCMAFAGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDD
DGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIEL
AIIRRNQPLKMFSAKEVELYVTEIEKEKEEAEKKKSKKSV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001025096
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001025096.2
RefSeq Size 1827 bp
RefSeq ORF 753 bp
Locus ID 143471
UniProt ID Q8TAA3
Cytogenetics 18q11.2
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
MW 27.7 kDa
Gene Summary Component of the spermatoproteasome, a form of the proteasome specifically found in testis that promotes degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.