MRP6 (ABCC6) (NM_001079528) Human Tagged ORF Clone
CAT#: RC213357
- TrueORF®
ABCC6 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_001079528" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | MRP6 |
Synonyms | ABC34; ARA; EST349056; GACI2; MLP1; MOAT-E; MOATE; MRP6; PXE; PXE1; URG7 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213357 representing NM_001079528
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGCGCCTGCTGAGCCCTGCGCGGGGCAGGGGGTCTGGAACCAGACAGAGCCTGAACCTGCCGCCA CCAGCCTGCTGAGCCTGTGCTTCCTGAGAACAGCAGGGGTCTGGGTACCCCCCATGTACCTCTGGGTCCT TGGTCCCATCTACCTCCTCTTCATCCACCACCATGGCCGGGGCTACCTCCGGATGTCCCCACTCTTCAAA GCCAAGATGGTAGCTGCCATCCCTGGGAGCCTGGAACCAGGCAATGTTCGGGGGAGGCAGGGGACAGGCT GGAACCTGGTGAAGTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213357 representing NM_001079528
Red=Cloning site Green=Tags(s) MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFK AKMVAAIPGSLEPGNVRGRQGTGWNLVKS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001079528 |
ORF Size | 297 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001079528.4 |
RefSeq Size | 727 bp |
RefSeq ORF | 300 bp |
Locus ID | 368 |
UniProt ID | O95255 |
Cytogenetics | 16p13.11 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | ABC transporters |
MW | 10.6 kDa |
Gene Summary | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213357L1 | Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC213357L2 | Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RC213357L3 | Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC213357L4 | Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RG213357 | ABCC6 (tGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2 |
USD 350.00 |
|
SC315468 | ABCC6 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 6 (ABCC6), transcript variant 2 |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review