Urotensin II (UTS2) (NM_006786) Human Tagged ORF Clone
CAT#: RC211368
- TrueORF®
UTS2 (Myc-DDK-tagged)-Human urotensin 2 (UTS2), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_006786" in other vectors (4)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Urotensin II |
Synonyms | PRO1068; U-II; UCN2; UII |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC211368 representing NM_006786
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTATAAGCTGGCCTCCTGCTGTTTGCTTTTCATAGGATTCTTAAATCCTCTCTTATCTCTTCCTCTCC TTGACTCCAGGGAAATATCCTTTCAACTCTCAGCACCTCATGAAGACGCGCGCTTAACTCCGGAGGAGCT AGAAAGAGCTTCCCTTCTACAGATACTGCCAGAGATGCTGGGTGCAGAAAGAGGGGATATTCTCAGGAAA GCAGACTCAAGTACCAACATTTTTAACCCAAGAGGAAATTTGAGAAAGTTTCAGGATTTCTCTGGACAAG ATCCTAACATTTTACTGAGTCATCTTTTGGCCAGAATCTGGAAACCATACAAGAAACGTGAGACTCCTGA TTGCTTCTGGAAATACTGTGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC211368 representing NM_006786
Red=Cloning site Green=Tags(s) MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRK ADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006786 |
ORF Size | 372 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006786.4 |
RefSeq Size | 584 bp |
RefSeq ORF | 375 bp |
Locus ID | 10911 |
UniProt ID | O95399 |
Cytogenetics | 1p36.23 |
Protein Families | Secreted Protein |
MW | 14.3 kDa |
Gene Summary | This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC211368L3 | Lenti-ORF clone of UTS2 (Myc-DDK-tagged)-Human urotensin 2 (UTS2), transcript variant 2 |
USD 540.00 |
|
RC211368L4 | Lenti-ORF clone of UTS2 (mGFP-tagged)-Human urotensin 2 (UTS2), transcript variant 2 |
USD 540.00 |
|
RG211368 | UTS2 (tGFP-tagged) - Human urotensin 2 (UTS2), transcript variant 2 |
USD 440.00 |
|
SC303827 | UTS2 (untagged)-Human urotensin 2 (UTS2), transcript variant 2 |
USD 225.00 |
{0} Product Review(s)
Be the first one to submit a review