Relaxin 1 (RLN1) (NM_006911) Human Tagged ORF Clone

CAT#: RC203283

RLN1 (Myc-DDK-tagged)-Human relaxin 1 (RLN1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_006911" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-RLN1 Antibody
    • 100 ul

USD 380.00

Other products for "Relaxin 1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Relaxin 1
Synonyms bA12D24.3.1; bA12D24.3.2; H1; H1RLX; RLXH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203283 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCGCCTGTTCTTGTTCCACCTGCTAGAATTCTGTTTACTACTGAACCAATTTTCCAGAGCAGTCG
CGGCCAAATGGAAGGACGATGTTATTAAATTATGCGGCCGCGAATTAGTTCGCGCGCAGATTGCCATTTG
CGGCATGAGCACCTGGAGCAAAAGGTCTCTGAGCCAGGAAGATGCTCCTCAGACACCTAGACCAGTGGCA
GAAATTGTACCATCCTTCATCAACAAAGATACAGAAACTATAATTATCATGTTGGAATTCATTGCTAATT
TGCCACCGGAGCTGAAGGCAGCCCTATCTGAGAGGCAACCATCATTACCAGAGCTACAGCAGTATGTACC
TGCATTAAAGGATTCCAATCTTAGCTTTGAAGAATTTAAGAAACTTATTCGCAATAGGCAAAGTGAAGCC
GCAGACAGCAATCCTTCAGAATTAAAATACTTAGGCTTGGATACTCATTCTCAAAAAAAGAGACGACCCT
ACGTGGCACTGTTTGAGAAATGTTGCCTAATTGGTTGTACCAAAAGGTCTCTTGCTAAATATTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203283 protein sequence
Red=Cloning site Green=Tags(s)

MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA
EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEA
ADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006911
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006911.4
RefSeq Size 1019 bp
RefSeq ORF 558 bp
Locus ID 6013
UniProt ID P04808
Cytogenetics 9p24.1
Domains IlGF
Protein Families Secreted Protein
MW 21.1 kDa
Gene Summary Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by this gene is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. [provided by RefSeq, Jan 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.