DUSP26 (NM_024025) Human Tagged ORF Clone

CAT#: RC200202

DUSP26 (Myc-DDK-tagged)-Human dual specificity phosphatase 26 (putative) (DUSP26)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_024025" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-DUSP26 Antibody
    • 100 ul

USD 380.00

Other products for "DUSP26"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DUSP26
Synonyms DSP-4; DUSP24; LDP-4; LDP4; MKP-8; MKP8; NATA1; NEAP; SKRP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200202 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCCTGGTAACTGGCTTTGGGCTTCTATGACTTTTATGGCCCGCTTCTCCCGGAGTAGCTCAAGGT
CTCCTGTTCGAACTCGAGGGACCCTGGAGGAGATGCCAACCGTTCAACATCCTTTCCTCAATGTCTTCGA
GTTGGAGCGGCTCCTCTACACAGGCAAGACAGCCTGTAACCATGCCGACGAGGTCTGGCCAGGCCTCTAT
CTCGGAGACCAGGACATGGCTAACAACCGCCGGGAGCTTCGCCGCCTGGGCATCACGCACGTCCTCAATG
CCTCACACAGCCGGTGGCGAGGCACGCCCGAGGCCTATGAGGGGCTGGGCATCCGCTACCTGGGTGTTGA
GGCCCACGACTCGCCAGCCTTTGACATGAGCATCCACTTCCAGACGGCTGCCGACTTCATCCACCGGGCG
CTGAGCCAGCCAGGAGGGAAGATCCTGGTGCATTGTGCTGTGGGCGTGAGCCGATCCGCCACCCTGGTAC
TGGCCTACCTCATGCTGTACCACCACCTTACCCTCGTGGAGGCCATCAAGAAAGTCAAAGACCACCGAGG
CATCATCCCCAACCGGGGCTTCCTGAGGCAGCTCCTGGCCCTGGACCGCAGGCTGCGGCAGGGTCTGGAA
GCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200202 protein sequence
Red=Cloning site Green=Tags(s)

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLY
LGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRA
LSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLE
A

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024025
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024025.3
RefSeq Size 1665 bp
RefSeq ORF 636 bp
Locus ID 78986
UniProt ID Q9BV47
Cytogenetics 8p12
Domains DSPc
Protein Families Druggable Genome, Phosphatase
MW 23.9 kDa
Gene Summary This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.