Rad51c (NM_001291440) Mouse Tagged ORF Clone

CAT#: MR229637

  • TrueORF®

Rad51c (myc-DDK-tagged) - Mouse RAD51 homolog C (Rad51c), transcript variant 1


  "NM_001291440" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Rad51c"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Rad51c
Synonyms R51H3; Rad51l2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229637 representing NM_001291440
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTACAGGGTTCACTTGGCCTGGCTACCGTCTCCGCGTCTCCGGCCTCTTTTTTTGTTTTTGTGTT
CACTGTCAGGCTATATCCGAAACGTGACTCGGACGAGTGAAACTAGAAGACAACCTTACATGAAACCAGT
GTGTGGGATTTCCTCAGCAGCAGCAAGGCCTCAAGTTGGGATATCTAAAGAGGAAGCCTTGGAAACTCTA
CAAATTCTAAGAAGAGAATGTCTCACAAATAAACCAAGATGTGCCGGTACATCTGTGGCAAACGAGAAGT
GCACAGCACTGGAACTTCTCGAGCAAGAGCATACCCAGGGCTTCATAATCACCTTCTGTTCAGCACTCGA
TAACATTCTTGGGGGTGGAATACCCCTAATGAAGACGACAGAAGTTTGTGGTGTACCAGGTGTTGGAAAA
ACACAGTTATGTATGCAATTGGCAGTAGATGTGCAGATTCCAGAATGTTTTGGGGGCGTGGCCGGTGAAG
CAGTATTTATTGATACAGAGGGAAGTTTTATGGTTGATAGAGTGGTCAGCCTTGCAACTGCCTGCATTCA
GCACCTTCATCTCATAGCAGGAACACACACGGAAGAAGAACATCAGAAAGCCTTGAAGGATTTTACTCTT
GAAAATATTCTTTCCCATATTTATTATTTTCGTTGTCATGATTATACTGAGCTGCTGGCACAAGTCTATC
TCCTTCCAGATTTCCTTTCAGATCATCCAAAGGTGCAGCTAGTGATAATAGACGGAATTGCTTTTCCCTT
TCGTCATGACCTTGAAGATCTATCCCTTCGTACTCGATTACTAAATGGCCTCGCCCAACAAATGATCAGC
CTTGCAAATAATCACAGATTAGCTGTTATTTTAACTAATCAGATGACAACAAAGATTGATAAAAATCAAG
CTTTGCTTGTTCCTGCATTAGGGGAAAGCTGGGGGCATGCTGCTACAATAAGGCTCATTTTTCACTGGGA
ACAAAAGCAAAGATTTGCAACATTGTACAAGTCACCAAGCCAGAAGGAGTCTACGATACCATTTCAGATC
ACACCTCAGGGATTTAGAGACGCTGTTGTCACTGCTGCCTCATCACAGACAGAGAGTTCTTTGAATTTCC
GGAAACGGTCACGAGAACCAGAGGAAGAATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229637 representing NM_001291440
Red=Cloning site Green=Tags(s)

MLYRVHLAWLPSPRLRPLFLFLCSLSGYIRNVTRTSETRRQPYMKPVCGISSAAARPQVGISKEEALETL
QILRRECLTNKPRCAGTSVANEKCTALELLEQEHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGK
TQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTL
ENILSHIYYFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMIS
LANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRLIFHWEQKQRFATLYKSPSQKESTIPFQI
TPQGFRDAVVTAASSQTESSLNFRKRSREPEEEC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001291440
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001291440.2
RefSeq Size 3122 bp
RefSeq ORF 1155 bp
Locus ID 114714
UniProt ID Q924H5
Cytogenetics 11 52.08 cM
MW 43.5 kDa
Gene Summary Essential for the homologous recombination (HR) pathway of DNA repair. Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Part of the RAD21 paralog protein complexes BCDX2 and CX3 which act at different stages of the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 seems to act downstream of BRCA2 recruitment and upstream of RAD51 recruitment; CX3 seems to act downstream of RAD51 recruitment; both complexes bind predominantly to the intersection of the four duplex arms of the Holliday junction (HJ) and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway. Involved in RAD51 foci formation in response to DNA damage suggesting an involvement in early stages of HR probably in the invasion step. Has an early function in DNA repair in facilitating phosphorylation of the checkpoint kinase CHEK2 and thereby transduction of the damage signal, leading to cell cycle arrest and HR activation. Participates in branch migration and HJ resolution and thus is important for processing HR intermediates late in the DNA repair process; the function may be linked to the CX3 complex. Part of a PALB2-scaffolded HR complex containing BRCA2 and which is thought to play a role in DNA repair by HR. Protects RAD51 from ubiquitin-mediated degradation that is enhanced following DNA damage. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and XRCC3. Contributes to DNA cross-link resistance, sister chromatid cohesion and genomic stability. Involved in maintaining centrosome number in mitosis.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.