Rab27a (NM_001301232) Mouse Tagged ORF Clone

CAT#: MR228590

Rab27a (myc-DDK-tagged) - Mouse RAB27A, member RAS oncogene family (Rab27a), transcript variant 3

Product Images

Circular map for MR228590

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rab27a
• Synonyms: 2210402C08Rik; 2410003M20Rik; 4933437C11Rik; ash
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228590 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGGATGGAGATTACGATTACCTCATCAAGTTCTTGGCCTTGGGAGACTCTGGGGTAGGGAAGACCA
  GTGTACTCTACCAGTACACTGATGGCAAGTTCAACTCCAAATTCATCACCACAGTGGGCATTGATTTCAG
  GGAAAAGAGAGTGGTGTACAGAGCCAATGGGCCAGATGGAGCTGTGGGCCGAGGCCAGAGAATCCACCTG
  CAGTTATGGGACACGGCGGGGCAGGAGAGGTTTCGTAGCTTAACCACTGCATTCTTCAGGGACGCTATGG
  GTTTCCTGCTTCTGTTCGACCTGACAAATGAGCAAAGTTTCCTCAATGTCCGAAACTGGATAAGCCAGCT
  ACAGATGCACGCGTACTGTGAAAACCCAGATATAGTGCTGTGTGGAAATAAGAGTGACCTGGAAGACCAG
  AGGGCAGTGAAAGAGGAGGAGGCCCGGGAACTTGCCGAGAAGTACGGAATCCCCTATTTTGAAACCAGTG
  CTGCCAACGGGACAAACATAAGCCACGCGATTGAGATGCTCCTGGACCTGATCATGAAGCGGATGGAGCG
  GTGTGTGGACAAGTCCTGGATTCCGGAGGGAGTGGTACGGTCCAACGGCCATACCTCTGCGGATCAGCTA
  AGTGAGGAGAAGGAGAAGGGGTTGTGTGGCTGT
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228590 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHL
  QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
  RAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQL
  SEEKEKGLCGC
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001301232
• ORF Size: 663 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001301232.1, NP_001288161.1
• RefSeq Size: 3108 bp
• RefSeq ORF: 666 bp
• Locus ID: 11891
• UniProt ID: Q9ERI2
• Cytogenetics: 9 40.08 cM
• MW: 25 kDa
• Gene Summary: The protein encoded by this gene is a member of the Rab family of proteins, which is the largest family within the Ras superfamily of GTPases. This gene product is thought to regulate vesicular transport, together with its specific effectors. Mutations in this gene cause several defects, including actin-based melanosome transport defects and immunodeficiency. Mutations in the human ortholog of this gene are associated with Griscelli syndrome type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]