Sigmar1 (NM_001286542) Mouse Tagged ORF Clone

CAT#: MR227914

Sigmar1 (myc-DDK-tagged) - Mouse sigma non-opioid intracellular receptor 1 (Sigmar1), transcript variant 6

Product Images

Circular map for MR227914

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Sigmar1
• Synonyms: mSig; O; Oprs1; Si; Sig1R; sigma1R
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR227914 representing NM_001286542
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGTGGGCCGCGGGACGGCGGTGGGCATGGATCACCCTGATTCTGACTATTATCGCAGTGCTGATCC
  AGGCCGCCTGGTTGTGGCTGGGCACTCAAAACTTCGTCTTCTACCCAGGAGAGACAGTTGTACACGGGCC
  TGGAGAAGCAACGGCTCTGGAGTGGGGACCAAACACGTGGATGGTGGAGTACGGCCGGGGTGTTATTCCG
  TCTACCCTGTTCTTTGCACTAGCCGACACTTTCTTCAGCACCCAGGACTACCTCACACTCTTCTATACCC
  TTCGGGCCTATGCCCGGGGCCTCCGGCTTGAGCTTACCACCTACCTCTTTGGCCAAGACTCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR227914 representing NM_001286542
  Red=Cloning site Green=Tags(s)
  
  MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIP
  STLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001286542
• ORF Size: 342 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001286542.1, NP_001273471.1
• RefSeq Size: 1313 bp
• RefSeq ORF: 345 bp
• Locus ID: 18391
• Cytogenetics: 4 A5
• MW: 13.5 kDa
• Gene Summary: This gene encodes a transmembrane protein located in the endoplasmic reticulum. The encoded protein is a receptor that binds several endogenous ligands, including N,N-dimethyltryptamine, progesterone and pregnenolone and a variety of of non-opiate compounds. The encoded protein plays a role in regulating the activity of ion channels, acting as a chaperone and protecting cells from oxidative stress. In humans, this receptor has been associated with Alzheimer's and Parkinson's diseases, stroke and numerous disease conditions such as depression, pain and addiction. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2013]