Dynll1 (NM_019682) Mouse Tagged ORF Clone
CAT#: MR219424
- TrueORF®
Dynll1 (Myc-DDK-tagged) - Mouse dynein light chain LC8-type 1 (Dynll1)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_019682" in other vectors (4)
Interest in protein/lysate? Submit request here!
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Dynll1 |
Synonyms | Dlc8; Dnclc1; Pin |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR219424 representing NM_019682
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCGACCGGAAGGCGGTGATCAAAAATGCAGACATGTCGGAAGAGATGCAACAGGACTCGGTGGAGT GCGCTACCCAGGCGTTGGAGAAGTACAACATCGAGAAGGATATTGCGGCCCATATCAAGAAGGAGTTTGA CAAGAAGTACAACCCTACCTGGCACTGCATTGTGGGCCGAAACTTCGGTAGTTATGTGACACATGAAACC AAACACTTCATCTACTTCTACCTGGGTCAGGTGGCCATTCTTCTGTTCAAATCTGGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR219424 representing NM_019682
Red=Cloning site Green=Tags(s) MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_019682 |
ORF Size | 267 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_019682.4, NP_062656.3 |
RefSeq Size | 2037 bp |
RefSeq ORF | 270 bp |
Locus ID | 56455 |
UniProt ID | P63168 |
Cytogenetics | 5 F |
MW | 10.8 kDa |
Gene Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC210057 | Dynll1 (untagged) - Mouse dynein light chain LC8-type 1 (Dynll1), (10ug) |
USD 240.00 |
|
MG219424 | Dynll1 (tGFP-tagged) - Mouse dynein light chain LC8-type 1 (Dynll1), (10ug) |
USD 425.00 |
|
MR219424L3 | Lenti ORF clone of Dynll1 (Myc-DDK-tagged) - Mouse dynein light chain LC8-type 1 (Dynll1) |
USD 525.00 |
|
MR219424L4 | Lenti ORF clone of Dynll1 (mGFP-tagged) - Mouse dynein light chain LC8-type 1 (Dynll1) |
USD 525.00 |
{0} Product Review(s)
Be the first one to submit a review