Sh2b1 (BC011422) Mouse Tagged ORF Clone

CAT#: MR207066

  • TrueORF®

Sh2b1 (Myc-DDK-tagged) - Mouse SH2B adaptor protein 1 (cDNA clone MGC:11623 IMAGE:3156603)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "BC011422" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Sh2b1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sh2b1
Synonyms SH2-Bb, SH2-B, mKIAA1299
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR207066 representing BC011422
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGGTGCCCCTTCCCCAGAGGATGGGGTCTTCCCTTCTCCGCCAGCGCTGCCACCACCCCCTCCCC
CAAGTTGGCAAGAGTTCTGTGAGTCCCATGCGAGGGCAGCTGCCCTGGATCTTGCCCGACGTTTTCGCCT
CTACCTGGCCTCCCACCCACAGTATGCAGAGCCGGGAGCAGAGGCCGCTTTTTCTGGCCGTTTTGCTGAG
CTCTTCCTGCAGCACTTCGAAGCCGAGGTGGCTCGGGCCTCGGGCTCACTCTCCCCACCTGTCCTGGCTC
CATTGAGCCCTGGTGTGGAAATCCCACCATCACACGACCTGTCCCTTGAGAGCTGCAGGGTGGGTGGGCC
CCTAGCAGTGTTGGGCCCTTCTCGATCTTCTGAGGACCTGGCTGGCCCCCTTCCTTCCTCAGTCCCTTCC
TCTACAACATCCTCAAAGCCAAAGCTCAAGAAGCGCTTCTCCCTCCGCTCAGTGGGCCGTTCAGTCAGAG
GCTCTGTTCGAGGCATCCTGCAGTGGCGGGGTGCCGTTGACTCGCCCTCCCAAGCTGGGCCTCTGGAGAC
CACATCCGGCCCTCCAGTTCTAGGTGGAAACAGCAACTCCAACTCCTCGGGTGGTGCTGGGACAGTTGGT
AGGGCATTGGCTAATGATGGCACATCCCCTGGGGAGAGATGGACTCATCGATTTGAGAGGCTGAGGCTAA
GTCGTGGAGGGGGAACCCTGAAAGACGGAGCAGGAATGATACAGAGAGAAGAGCTGCTGAGTTTCATGGG
GGCTGAAGAGGCTGCCCCTGACCCAGCAGGAGTGGGTCGTGGAGGAGGGGCAGCTGGGCTGACCTCAGGA
GGAGGAGGGCAGCCTCAGTGGCAAAAGTGTCGCTTACTGCTCCGGAGTGAAGGAGAAGGAGGAGGAGGAA
GTCGCTTGGAGTTCTTTGTACCACCCAAGGCGTCCCGACCCCGTCTCAGCATTCCCTGCTCTACTATTAC
TGATGTCCGCACAGCCACAGCCCTAGAGATGCCTGACAGGGAGAACACGTTTGTGGTTAAGGTAGAAGGC
CCTTCAGAGTACATCCTGGAGACAAGTGATGCGCTTCATGTGAAGGCCTGGGTGTCTGACATCCAGGAAT
GCCTAAGCCCCGGACCCTGTCCTGCTATCAGCCCCCGTCCCATGACCCTTCCCCTGGCCCCTGGGACCTC
CTTCCTCACAAAGGATAACACAGACAGCCTGGAGTTGCCCTGCCTGAATCATTCAGAGAGTCTGCCTAGC
CAGGATCTGCTGCTGGGACCCAGCGAGAGTAACGACCGCCTGTCGCAGGCTGTTGATTCAGAAAAGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207066 representing BC011422
Red=Cloning site Green=Tags(s)

MNGAPSPEDGVFPSPPALPPPPPPSWQEFCESHARAAALDLARRFRLYLASHPQYAEPGAEAAFSGRFAE
LFLQHFEAEVARASGSLSPPVLAPLSPGVEIPPSHDLSLESCRVGGPLAVLGPSRSSEDLAGPLPSSVPS
STTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGAVDSPSQAGPLETTSGPPVLGGNSNSNSSGGAGTVG
RALANDGTSPGERWTHRFERLRLSRGGGTLKDGAGMIQREELLSFMGAEEAAPDPAGVGRGGGAAGLTSG
GGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSTITDVRTATALEMPDRENTFVVKVEG
PSEYILETSDALHVKAWVSDIQECLSPGPCPAISPRPMTLPLAPGTSFLTKDNTDSLELPCLNHSESLPS
QDLLLGPSESNDRLSQAVDSEKT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC011422
ORF Size 1329 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC011422.1
RefSeq Size 2960 bp
RefSeq ORF 1331 bp
Locus ID 20399
Cytogenetics 7 69.06 cM
MW 108.5 kDa
Gene Summary Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor I (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity (By similarity). Isoforms seem to be differentially involved in IGF-I and PDGF-induced mitogenesis, according the order: isoform 3 > isoform 4 > isoform 1 > isoform 2.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.