Aurka (NM_011497) Mouse Tagged ORF Clone

CAT#: MR206590

  • TrueORF®

Aurka (Myc-DDK-tagged) - Mouse aurora kinase A (Aurka)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_011497" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Aurka"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Aurka
Synonyms AIRK1; ARK-1; Ark1; AU019385; Aurora-A; AW539821; Ayk1; IAK; IAK1; Stk6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206590 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTTGAGGGCGAGCCTGGATGCTGCAAACGGATAGGGAAGGCTGTGTGGCGTCGGGGTGACATGG
ACAGATGTAAAGAAAACTGTGTCTCCAGGCCTGTTAAGACCACTGTTCCCTTCGGTCCGAAACGCGTCTT
GGTGACTGAGCAGATTCCATCTCAGAACCTAGGATCTGCTAGCAGTGGCCAGGCCCAGCGGGTCCTGTGT
CCTTCTAACTCCCAGCGTGTCCCTTCACAAGCCCAGAAACTTGGAGCAGGTCAGAAGCCGGCACCAAAGC
AGTTGCCAGCTGCCAGTGTTCCTCGACCTGTGTCCCGGCTCAATAACCCCCAGAAGAATGAGCAGCCTGC
AGCCTCCGGAAATGATTCTGAAAAGGAGCAGGCATCCTTGCAGAAGACCGAAGACACAAAAAAAAGGCAG
TGGACTTTGGAAGATTTTGACATTGGCCGCCCACTAGGAAAAGGGAAGTTTGGAAATGTCTACTTGGCGC
GGGAGAGACAAAGCAAGTTCATCCTGGCTCTGAAGGTGCTGTTTAAAACACAGCTGGAGAAGGCGAACGT
GGAGCACCAGCTTCGGAGAGAGGTGGAGATCCAGTCGCACCTGCGGCACCCCAACATCCTCAGGCTGTAT
GGCTATTTCCATGACGCCACCCGAGTTTATCTGATTCTAGAATATGCGCCCCTTGGAACAGTCTATAGAG
AGCTCCAAAAACTCTCCAAGTTTGACGAGCAGAGAACAGCTACTTACATCACTGAGTTGGCAAACGCTCT
GTCTTACTGTCATTCAAAGAGAGTGATCCACAGAGACATTAAGCCAGAGAACTTACTGCTTGGCTCAAAC
GGAGAGTTGAAGATTGCAGACTTCGGGTGGTCGGTGCATGCTCCATCTTCCAGGAGAACCACAATGTGTG
GCACCCTGGACTACCTGCCCCCAGAGATGATTGAAGGCCGGATGCATGACGAGAAGGTGGACCTCTGGAG
CCTGGGCGTTCTCTGCTATGAGTTCCTAGTGGGGATGCCTCCTTTCGAGGCACATACGTACCAGGAGACT
TACAGAAGGATATCTCGGGTTGAATTCACTTTCCCTGACTTTGTGACAGAGGGAGCCAGGGACCTCATTT
CAAGACTGTTAAAACACAACGCAAGCCAAAGGCTAACACTAGCGGAAGTCCTTGAGCACCCTTGGATCAA
AGCTAATTCTTCCAAACCTCCAACTGGCCACACTAGCAAAGAGCCAACCAGCAAATCATCT


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>MR206590 protein sequence
Red=Cloning site Green=Tags(s)

MAVEGEPGCCKRIGKAVWRRGDMDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLC
PSNSQRVPSQAQKLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQ
WTLEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLY
GYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSN
GELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQET
YRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS

TRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011497
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011497.2
RefSeq Size 1975 bp
RefSeq ORF 1254 bp
Locus ID 20878
UniProt ID P97477
Cytogenetics 2 94.84 cM
MW 47.2 kDa
Gene Summary Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase (By similarity). Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Important for microtubule formation and/or stabilization. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and stabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Necessary for proper cilia disassembly prior to mitosis.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.