Eif4a3 (NM_138669) Mouse Tagged ORF Clone

CAT#: MR206460

  • TrueORF®

Eif4a3 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4A3 (Eif4a3)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_138669" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

4 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Eif4a3"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Eif4a3
Synonyms 2400003O03Rik; Ddx48; eIF4A-III; mKIAA0111
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206460 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTAACGCCACGATGGCGACGTCTGGCTCGGCGCGGAAGCGGCTGCTCAAAGAGGAGGACATGA
CCAAAGTGGAGTTCGAGACGAGCGAGGAGGTGGACGTGACCCCCACGTTCGACACCATGGGCCTGCGAGA
GGACCTGCTGCGCGGCATCTACGCCTACGGTTTTGAAAAACCTTCAGCGATTCAGCAGCGTGCTATCAAG
CAGATAATTAAAGGGAGAGATGTCATTGCACAGTCTCAGTCTGGCACAGGCAAGACGGCCACCTTCAGTG
TCTCAGTGCTGCAGTGCTTGGATATCCAGGTTCGAGAAACCCAAGCTTTGATCCTGGCTCCAACCAGGGA
GTTAGCGGTGCAGATTCAGAAGGGTCTGCTCGCGCTGGGGGATTACATGAACGTGCAGTGCCATGCCTGC
ATTGGGGGCACCAACGTCGGCGAGGACATCCGGAAGCTGGACTACGGACAGCACGTGGTGGCAGGCACGC
CGGGACGCGTCTTTGATATGATCCGCCGGAGAAGTTTACGGACACGGGCTATCAAGATGCTGGTTTTGGA
TGAGGCTGATGAAATGTTGAACAAAGGTTTCAAGGAGCAGATCTATGATGTGTACAGGTACTTGCCACCA
GCCACACAGGTCGTCCTCATCAGCGCCACACTGCCTCATGAGATCCTGGAGATGACCAACAAGTTCATGA
CCGACCCCATCCGCATCTTGGTGAAGCGTGATGAGTTGACTCTGGAAGGCATCAAACAGTTCTTTGTGGC
TGTGGAAAGAGAGGAATGGAAATTTGATACTCTATGTGATCTCTATGACACGCTGACCATCACCCAGGCC
GTCATCTTCTGCAACACCAAGCGGAAGGTTGACTGGCTGACAGAGAAAATGAGAGAAGCCAATTTCACTG
TGTCGTCCATGCATGGAGACATGCCCCAGAAAGAACGAGAGTCTATCATGAAGGAGTTCCGGTCAGGTGC
CAGCCGGGTGCTCATCTCCACAGACGTCTGGGCCCGGGGCCTGGATGTCCCTCAGGTGTCCCTCATCATT
AACTACGACCTGCCCAACAACAGAGAACTGTACATTCACAGAATTGGGAGATCGGGTCGGTATGGACGAA
AAGGTGTGGCCATCAATTTTGTGAAGAATGATGACATCCGGATTCTCAGGGACATTGAGCAGTACTACTC
CACCCAGATAGACGAGATGCCCATGAATGTGGCTGACCTCATC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>MR206460 protein sequence
Red=Cloning site Green=Tags(s)

MAANATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK
QIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC
IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP
ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA
VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_138669
ORF Size 1236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_138669.1, NP_619610.1
RefSeq Size 1489 bp
RefSeq ORF 1236 bp
Locus ID 192170
UniProt ID Q91VC3
Cytogenetics 11 E2
MW 46.8 kDa
Gene Summary ATP-dependent RNA helicase. Involved in pre-mRNA splicing as component of the spliceosome. Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH-RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The inhibition of ATPase activity by the MAGOH-RBM8A heterodimer increases the RNA-binding affinity of the EJC. Involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex. Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Shows higher affinity for single-stranded RNA in an ATP-bound core EJC complex than after the ATP is hydrolyzed. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms; the function is different from the established EJC assembly. Involved in craniofacial development.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.