Cops6 (NM_012002) Mouse Tagged ORF Clone

CAT#: MR204710

  • TrueORF®

Cops6 (Myc-DDK-tagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_012002" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Cops6"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Cops6
Synonyms Sgn3; VIP/MOV34
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204710 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCAGCTGCGGCGGGGGCGAATGGGAGCGGAGGCAGCAGCGGCATGGAAGTGGATGCAGCAG
TCCCCAGCGTGATGGCCTCCGGAGTGACTGGGAGTGTTTCCGTCGCTCTTCATCCCCTTGTCATCCTTAA
CATCTCAGACCATTGGATCCGCATGCGCTCCCAGGAGGGGCGGCCTATGCAGGTGATTGGGGCTCTGATC
GGGAAGCAGGAGGGGCGAAATATCGAAGTGATGAACTCCTTTGAGCTGCTGTCCCACACCGTGGAAGAGA
AGATTATCATTGACAAAGAATATTATTACACCAAGGAGGAGCAGTTTAAACAGGTTTTCAAGGAGCTGGA
GTTTCTGGGTTGGTATACCACAGGGGGGCCACCTGACCCCTCAGACATCCACGTCCATAAGCAGGTGTGT
GAGATAATTGAGAGTCCGCTCTTTCTGAAGTTGAACCCTATGACCAAGCACACAGATCTTCCTGTCAGCG
TTTTTGAGTCTGTCATCGATATAATCAATGGAGAGGCCACAATGCTGTTTGCTGAGCTCACTTACACTCT
GGCCACTGAGGAAGCTGAACGGATCGGTGTAGACCACGTGGCCCGGATGACAGCAACAGGCAGTGGGGAG
AACTCCACTGTGGCTGAACACCTGATAGCTCAGCATAGTGCCATCAAGATGCTGCACAGCCGTGTGAAGC
TCATTTTAGAATATGTCAAGGCCTCTGAAGCAGGAGAGGTTCCCTTCAACCATGAGATCCTGCGGGAGGC
CTATGCCCTATGTCACTGTCTTCCAGTTCTCAGCACTGACAAGTTCAAGACAGACTTTTATGATCAATGC
AATGACGTGGGGCTCATGGCCTACCTCGGCACCATCACCAAAACGTGCAACACAATGAACCAGTTTGTGA
ACAAGTTCAACGTCCTCTACGACCGACAAGGCATTGGCCGGCGAATGCGGGGACTGTTTTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204710 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALI
GKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVC
EIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGE
NSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQC
NDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012002
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012002.3
RefSeq Size 1094 bp
RefSeq ORF 975 bp
Locus ID 26893
UniProt ID O88545
Cytogenetics 5 G2
MW 35.9 kDa
Gene Summary Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Has some glucocorticoid receptor-responsive activity (By similarity). Stabilizes COP1 through reducing COP1 auto-ubiquitination and decelerating COP1 turnover rate, hence regulates the ubiquitination of COP1 targets, including SFN (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.