Tbp (NM_013684) Mouse Tagged ORF Clone

CAT#: MR204589

  • TrueORF®

Tbp (Myc-DDK-tagged) - Mouse TATA box binding protein (Tbp)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_013684" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tbp
Synonyms Gtf2d; GTF2D1; SCA17; TFIID
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204589 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCAGAACAACAGCCTTCCACCTTATGCTCAGGGCTTGGCCTCCCCACAGGGCGCCATGACTCCTG
GAATTCCCATCTTTAGTCCAATGATGCCTTACGGCACAGGACTTACTCCACAGCCTATTCAGAACACCAA
CAGTCTCTCTATTTTGGAAGAGCAACAAAGACAGCAGCAGCAACAGCAACAGCAGCAGCAACAACAGCAG
GCAGTAGCAACTGCAGCAGCCTCAGTACAGCAATCAACATCTCAGCAACCCACACAGGGTGCCTCAGGCC
AGACCCCACAACTCTTCCATTCTCAAACTCTGACCACTGCACCGTTGCCAGGCACCACCCCCTTGTACCC
TTCACCAATGACTCCTATGACCCCTATCACTCCTGCCACACCAGCTTCTGAGAGCTCTGGAATTGTACCG
CAGCTTCAAAATATTGTATCTACCGTGAATCTTGGCTGTAAACTTGACCTAAAGACCATTGCACTTCGTG
CAAGAAATGCTGAATATAATCCCAAGCGATTTGCTGCAGTCATCATGAGAATAAGAGAGCCACGGACAAC
TGCGTTGATTTTCAGTTCTGGAAAAATGGTGTGCACAGGAGCCAAGAGCTATGAGCCAGAATTATTTCCT
GGATTAATCTACAGAATGATCAAACCCAGAATTGTTCTCCTTATTTTTGTTTCTGGAAAAGTTGTATTAA
CAGGTGCTAAAGTTAGAGCAGAGATTTATGAAGCATTTGAAAACATCTACCCCATCTTAAAGGGATTCAG
GAAGACCACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204589 protein sequence
Red=Cloning site Green=Tags(s)

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQ
AVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVP
QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSYEPELFP
GLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013684
ORF Size 783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013684.2, NP_038712.2
RefSeq Size 1842 bp
RefSeq ORF 951 bp
Locus ID 21374
UniProt ID P29037
Cytogenetics 17 8.95 cM
MW 28.3 kDa
Gene Summary General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II. Component of a BRF2-containing transcription factor complex that regulates transcription mediated by RNA polymerase III. Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1 with the rDNA promoter. SL1 is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.