Cnot7 (NM_011135) Mouse Tagged ORF Clone

CAT#: MR203889

  • TrueORF®

Cnot7 (Myc-DDK-tagged) - Mouse CCR4-NOT transcription complex, subunit 7 (Cnot7)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_011135" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


CNOT7 Rabbit polyclonal Antibody
    • 100 ul

USD 380.00

Other products for "Cnot7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Cnot7
Synonyms AU022737; CAF-1; Caf1; Pop2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203889 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCAGCAACCGTAGATCATAGCCAAAGAATTTGTGAAGTTTGGGCTTGTAACCTGGATGAAGAGA
TGAAGAAAATCCGTCAAGTTATCCGAAAATATAATTATGTTGCTATGGACACCGAGTTTCCAGGCGTTGT
TGCAAGACCCATTGGAGAATTCAGAAGCAATGCTGACTATCAGTACCAACTGTTGCGGTGTAATGTAGAC
TTGTTAAAGATAATCCAGCTCGGACTGACCTTTATGAATGAACAGGGAGAATACCCTCCAGGAACGTCAA
CTTGGCAGTTTAACTTTAAGTTTAATTTGACGGAGGACATGTATGCTCAGGACTCTATAGAGCTACTAAC
AACATCTGGTATCCAGTTTAAAAAACACGAGGAGGAAGGAATTGAGACCCAATATTTTGCAGAACTTCTT
ATGACTTCAGGAGTGGTTCTTTGTGAAGGGGTCAAATGGCTATCATTTCACAGTGGTTATGACTTTGGCT
ATTTAATCAAAATTCTGACCAACTCTAACTTGCCTGAGGAAGAACTTGATTTCTTTGAGATCCTTCGGTT
ATTTTTTCCTGTCATTTATGATGTGAAGTACCTCATGAAGAGCTGCAAAAATCTCAAAGGTGGATTACAG
GAAGTTGCTGAGCAGTTAGAGCTGGAGCGCATAGGCCCTCAGCACCAGGCAGGATCTGACTCACTGCTTA
CAGGAATGGCCTTTTTCAAAATGAGAGAAATGTTCTTTGAAGATCACATTGATGATGCCAAATACTGTGG
TCACTTATATGGCCTTGGTTCTGGCTCATCCTATGTACAGAACGGCACAGGGAATGCATATGAAGAGGAA
GCCAGCAAGCAGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203889 protein sequence
Red=Cloning site Green=Tags(s)

MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD
LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL
MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ
EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE
ASKQS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011135
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011135.5
RefSeq Size 2617 bp
RefSeq ORF 858 bp
Locus ID 18983
UniProt ID Q60809
Cytogenetics 8 A4
MW 32.7 kDa
Gene Summary Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.