Snai2 (NM_011415) Mouse Tagged ORF Clone

CAT#: MR203571

Snai2 (Myc-DDK-tagged) - Mouse snail homolog 2 (Drosophila) (Snai2)

Product Images

Circular map for MR203571

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Snai2
• Synonyms: Slug; Slugh; Snail2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR203571 representing NM_011415
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGCGCTCCTTCCTGGTCAAGAAACATTTCAACGCCTCCAAGAAGCCCAACTACAGCGAACTGGACA
  CACACACAGTTATTATTTCCCCATATCTCTATGAAAGTTACCCTATACCTGTCATACCAAAACCAGAGAT
  CCTCACCTCGGGAGCATACAGCCCTATTACTGTATGGACATCGTCGGCAGCTCCACTCCACTCTCCTTTA
  CCCAGTGGCCTTTCTCCTCTTACTGGATACTCCTCATCCTTGGGGCGTGTAAGTCCCCCGCCTTCCTCTG
  ACACTTCATCCAAGGATCACAGTGGTTCAGAAAGTCCCATTAGTGACGAAGAGGAGAGACTGCAGCCCAA
  GCTTTCAGACCCCCATGCCATCGAAGCTGAGAAGTTTCAGTGCAATTTATGCAATAAGACCTATTCTACG
  TTCTCTGGGCTGGCCAAACACAAGCAGCTGCACTGTGATGCCCAGTCTAGGAAATCGTTCAGCTGCAAGT
  ACTGTGACAAGGAATATGTGAGCCTGGGTGCCCTGAAGATGCACATTCGAACCCACACATTGCCTTGTGT
  CTGCAAGATCTGTGGCAAGGCTTTCTCCAGACCCTGGCTGCTTCAAGGACACATTAGAACTCACACTGGG
  GAAAAGCCTTTCTCTTGCCCTCACTGCAATAGGGCTTTTGCAGACAGATCAAACCTGAGGGCACATCTGC
  AGACCCACTCTGATGTAAAGAAATACCAGTGCAAAAACTGCTCCAAAACCTTCTCCAGAATGTCGCTTCT
  GCATAAACATGAGGAGTCTGGCTGCTGTGTGGCACAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR203571 representing NM_011415
  Red=Cloning site Green=Tags(s)
  
  MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYPIPVIPKPEILTSGAYSPITVWTSSAAPLHSPL
  PSGLSPLTGYSSSLGRVSPPPSSDTSSKDHSGSESPISDEEERLQPKLSDPHAIEAEKFQCNLCNKTYST
  FSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTG
  EKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_011415
• ORF Size: 807 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_011415.3
• RefSeq Size: 2084 bp
• RefSeq ORF: 810 bp
• Locus ID: 20583
• UniProt ID: P97469
• Cytogenetics: 16 10.07 cM
• MW: 30.5 kDa
• Gene Summary: Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis (By similarity).[UniProtKB/Swiss-Prot Function]