Arl6ip1 (NM_019419) Mouse Tagged ORF Clone

CAT#: MR202096

Arl6ip1 (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1)

Product Images

Circular map for MR202096

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Arl6ip1
• Synonyms: Aip-1; AIP-6; AL022945; Arl6ip; ARMER; AU042858; C85138; mKIAA0069
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202096 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGAGGGGGATAACCGCAGCAGCAACCTGCTGGCCGTGGAGACTGCAAGTCTTGAAGAGCAGCTGC
  AAGGCTGGGGAGAGGTGATGCTGATGGCTGACAAAGTCCTTCGATGGGAAAGAGCCTGGTTTCCACCTGC
  CATCATGGGTGTGGTTTCCCTGCTGTTCCTGATTATCTATTATCTCGATCCATCTGTGCTGTCTGGTGTT
  TCCTGCTTTGTTATGTTTTTGTGCCTGGCTGACTACCTTGTTCCCATTCTAGCACCAAGAATTTTTGGCT
  CTAATAAATGGACCACTGAACAACAGCAAAGATTTCATGAAATCTGCAGTAATCTAGTAAAAACTCGACG
  CAGAGCTGTGGGCTGGTGGAAACGCCTCTTTTCCCTAAAGGAAGAAAAGCCTAAAATGTACTTCATGACC
  ATGATCATTTCTCTTGCTGCGGTGGCTTGGGTGGGACAGCAAGTTCACAACCTGCTTCTCACCTACCTGA
  TTGTGACATTTGTGCTGTTGCTTCCTGGACTAAACCAACATGGGATCATTCTGAAGTACATTGGAATGGC
  CAAAAGGGAGATAAACAAACTTCTCAAGCAAAAAGAAAAGAAAAATGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202096 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGV
  SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMT
  MIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_019419
• ORF Size: 612 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_019419.2
• RefSeq Size: 2154 bp
• RefSeq ORF: 612 bp
• Locus ID: 54208
• UniProt ID: Q9JKW0
• Cytogenetics: 7 F1
• MW: 23.4 kDa
• Gene Summary: Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (PubMed:18684713). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation (By similarity).[UniProtKB/Swiss-Prot Function]