Selenof (NM_053102) Mouse Tagged ORF Clone

CAT#: MR201280

Sep15 (Myc-DDK-tagged) - Mouse selenoprotein (Sep15), (Note, selenocysteine protein, internal stop codon, see summary)

Product Images

Circular map for MR201280

Specifications

Product Data

• Type: Mouse Untagged ORF Clone
• Symbol: Selenof
• Synonyms: 9430015P09Rik; Sep; Sep15
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201280 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGCAGGGCAGGGTGGGTGGCTGCGGCCCGCTCTGGGGCTGCGCTTGCTGCTGGCGACTGCGTTTC
  AAGCGGTGTCTGCTCTGGGGGCAGAGTTTGCGTCAGAGGCATGCAGAGAGTTGGGTTTCTCCAGCAACTT
  GCTCTGCAGCTCTTGCGATCTTCTTGGACAGTTTAATCTGCTCCCACTGGACCCTGTTTGCAGAGGGTGC
  TGTCAGGAAGAAGCACAATTTGAAACCAAAAAGCTGTATGCAGGAGCCATCCTTGAAGTCTGCGGATGAA
  AATTGGGGAGGTTGCCTCAAGTCCAAGCTTTTGTCAGAAGTGATAAACCCAAACTCTTCAGAGGTCTACA
  GATCAAGTATGTTCGAGGCTCAGACCCTGTACTAAAGCTTTTGGACGACAACGGGAACATTGCTGAAGAA
  CTAAGCATCCTCAAATGGAACACAGACAGTGTGGAAGAGTTCCTGAGCGAGAAGTTGGAACGCATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201280 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFASEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGC
  CQEEAQFETKKLYAGAILEVCG*KLGRLPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE
  LSILKWNTDSVEEFLSEKLERI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_053102
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_053102.1, NM_053102.2, NP_444332.1
• RefSeq Size: 1515 bp
• RefSeq ORF: 489 bp
• Locus ID: 93684
• UniProt ID: Q9ERR7
• Cytogenetics: 3 H2
• Gene Summary: The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. Knockout studies in mice also suggest a role for this gene in cataract formation and colon carcinogenesis. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. [provided by RefSeq, Nov 2016]