Selenoh (NM_001033166) Mouse Tagged ORF Clone
CAT#: MR200498
- TrueORF®
2700094K13Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 2700094K13 gene (2700094K13Rik), transcript variant 1
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_001033166" in other vectors (2)
Interest in protein/lysate? Submit request here!
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Selenoh |
Synonyms | 2700094K13Rik; Se; Selh |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200498 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCCCCACGGAAGAAAGCGTAAGGCGGGGGCCGCGCCTATGGAGACGGTGGACAAGCGCGAGAAAC TGGCGGAGGGCGCGACCGTGGTCATTGAGCATTGTACGAGCTGACGCGTGTACGGCCGCCATGCTGCTGC CTTGAGCCAGGCTCTGCAACTGGAGGCCCCAGAGCTACCTGTGCAAGTGAACCCGTCCAAACCGCGGAGG GGCAGCTTCGAGGTGACGCTGCTGCGCTCGGACAACAGCCGTGTTGAACTCTGGACTGGTATTAAGAAGG GCCCTCCACGAAAGCTCAAATTTCCTGAGCCTCAAGAGGTGGTTGAAGAATTGAAGAAGTACCTTTCA AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA >MR200498 protein sequence
Red=Cloning site Green=Tags(s) MAPHGRKRKAGAAPMETVDKREKLAEGATVVIEHCTS*RVYGRHAAALSQALQLEAPELPVQVNPSKPRR GSFEVTLLRSDNSRVELWTGIKKGPPRKLKFPEPQEVVEELKKYLS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-RsrII Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001033166 |
ORF Size | 351 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001033166.3 |
RefSeq Size | 697 bp |
RefSeq ORF | 351 bp |
Locus ID | 72657 |
UniProt ID | Q3UQA7 |
Cytogenetics | 2 D |
MW | 12.9 kDa |
Gene Summary | This gene encodes a nucleolar protein, which belongs to the SelWTH family. It functions as an oxidoreductase, and has been shown to protect neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, promote mitochondrial biogenesis and mitochondrial function, and suppress cellular senescence through genome maintenance and redox regulation. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MR200498L3 | Lenti ORF clone of 2700094K13Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 2700094K13 gene (2700094K13Rik), transcript variant 1 |
USD 450.00 |
|
MR200498L4 | Lenti ORF clone of 2700094K13Rik (mGFP-tagged) - Mouse RIKEN cDNA 2700094K13 gene (2700094K13Rik), transcript variant 1 |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review