Fxyd6 (NM_022004) Mouse Tagged ORF Clone
CAT#: MR200251
- TrueORF®
Fxyd6 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_022004" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Fxyd6 |
Synonyms | 0610030I18Rik; P; Php |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200251 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGACGGTGCTGGTCCTCTGCAGCTTGCTGGCCCCTGTGGTCCTGGCGAGTGCTGAGAAGGAGAAAG AAAAGGATCCTTTCTATTACGACTACCAGACCCTGAGGATTGGGGGGTTGGTGTTTGCTGTGGTCCTCTT CTCCGTTGGGATACTTCTCATCCTCAGTCGCAGGTGCAAGTGCAGTTTCAATCAGAAGCCCAGGGCTCCA GGTGACGAAGAGGCCCAGGTGGAGAACCTCATCACTACAAACGCTGCGGAGCCCCAGAAGGCAGAGAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200251 protein sequence
Red=Cloning site Green=Tags(s) METVLVLCSLLAPVVLASAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAP GDEEAQVENLITTNAAEPQKAEN myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_022004 |
ORF Size | 282 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022004.1, NM_022004.2, NM_022004.3, NM_022004.4, NM_022004.5, NM_022004.6, NP_071287.1 |
RefSeq Size | 1804 bp |
RefSeq ORF | 285 bp |
Locus ID | 59095 |
UniProt ID | Q9D164 |
Cytogenetics | 9 A5.2 |
MW | 10.3 kDa |
Gene Summary | This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, Fxyd6, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Jul 2006] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC210195 | Fxyd6 (untagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6), (10ug) |
USD 165.00 |
|
MG200251 | Fxyd6 (tGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) |
USD 350.00 |
|
MR200251L3 | Lenti ORF clone of Fxyd6 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) |
USD 450.00 |
|
MR200251L4 | Lenti ORF clone of Fxyd6 (mGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review