Lsm6 (NM_030145) Mouse Tagged ORF Clone
CAT#: MR200135
- TrueORF®
Lsm6 (Myc-DDK-tagged) - Mouse LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm6), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_030145" in other vectors (4)
Interest in protein/lysate? Submit request here!
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Lsm6 |
Synonyms | 1500031N17Rik; 2410088K19Rik; AI747288 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200135 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCCTGCGGAAGCAAACCCCTAGCGACTTCTTAAAGCAGATCATCGGACGGCCAGTTGTGGTGAAAT TAAATTCTGGCGTGGATTATCGAGGGGTCCTGGCCTGCCTGGATGGCTACATGAATATAGCCCTGGAACA GACAGAGGAGTATGTAAATGGACAGCTGAAGAATAAGTACGGAGATGCGTTCATCCGAGGAAACAATGTG CTGTACATAAGTACACAGAAGAGGCGGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200135 protein sequence
Red=Cloning site Green=Tags(s) MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV LYISTQKRRM myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_030145 |
ORF Size | 243 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_030145.3 |
RefSeq Size | 3702 bp |
RefSeq ORF | 243 bp |
Locus ID | 78651 |
UniProt ID | P62313 |
Cytogenetics | 8 C1 |
MW | 9.1 kDa |
Gene Summary | Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC203203 | Lsm6 (untagged) - Mouse LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm6), transcript variant 2, (10ug) |
USD 150.00 |
|
MG200135 | Lsm6 (tGFP-tagged) - Mouse LSM6 homolog, U6 small nuclear RNA associated (S |
USD 350.00 |
|
MR200135L3 | Lenti ORF clone of Lsm6 (Myc-DDK-tagged) - Mouse LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm6), transcript variant 2 |
USD 450.00 |
|
MR200135L4 | Lenti ORF clone of Lsm6 (mGFP-tagged) - Mouse LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm6), transcript variant 2 |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review