Cd8b1 (NM_009858) Mouse Tagged ORF Clone

CAT#: MG225204

  • TrueORF®

Cd8b1 (tGFP-tagged) - Mouse CD8 antigen beta chain 1 (Cd8b1), (10ug)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_009858" in other vectors (4)

Reconstitution Protocol

USD 500.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Recombinant Anti-CD8 beta (Clone YTS 156.7.7)
    • 200 ug

USD 630.00

Other products for "Cd8b1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Cd8b1
Synonyms Cd8b; Ly-3; Ly-C; Lyt-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG225204 representing NM_009858
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCATGGCTCTGGCTGGTCTTCAGTATGAAGCTGGCAGCTCTCTGGAGCAGCTCTGCCCTCATTC
AGACCCCTTCGTCCCTGCTGGTTCAAACCAACCATACGGCAAAGATGTCCTGTGAGGTTAAAAGCATCTC
TAAGTTAACAAGCATCTACTGGCTGCGGGAGCGCCAGGACCCCAAGGACAAGTACTTTGAGTTCCTGGCC
TCCTGGAGTTCTTCCAAAGGAGTTTTGTATGGTGAAAGTGTGGACAAGAAAAGAAATATAATTCTTGAGT
CTTCAGACTCAAGACGGCCCTTTCTCAGTATCATGAATGTGAAGCCAGAGGACAGTGACTTCTACTTCTG
CGCGACGGTTGGGAGCCCCAAGATGGTCTTTGGGACAGGGACGAAGCTGACTGTGGTTGATGTCCTTCCT
ACAACTGCCCCAACCAAGAAGACTACCCTGAAGATGAAGAAGAAGAAGCAATGCCCGTTCCCCCACCCAG
AGACCCAGAAGGGCCTGACATGCAGCCTTACCACCCTCAGCCTGCTGGTAGTCTGCATCCTGCTTCTGCT
GGCATTCCTCGGAGTGGCCGTCTACTTTTACTGTGTGCGGAGGAGAGCCCGAATTCACTTCATGAAACAG
TTTCACAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225204 representing NM_009858
Red=Cloning site Green=Tags(s)

MQPWLWLVFSMKLAALWSSSALIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQDPKDKYFEFLA
SWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPKMVFGTGTKLTVVDVLP
TTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTTLSLLVVCILLLLAFLGVAVYFYCVRRRARIHFMKQ
FHK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009858
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009858.3
RefSeq Size 1416 bp
RefSeq ORF 642 bp
Locus ID 12526
UniProt ID P10300
Cytogenetics 6 32.14 cM
Gene Summary Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.