Wasl (NM_001167745) Mouse Tagged ORF Clone

CAT#: MG224732

  • TrueORF®

Wasl (tGFP-tagged) - Mouse Wiskott-Aldrich syndrome-like (human) (Wasl) transcript variant 2, (10ug)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001167745" in other vectors (3)

Reconstitution Protocol

USD 530.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Wasl"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Wasl
Synonyms 2900021I12Rik; 3110031I02Rik; N-WASP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG224732 representing NM_001167745
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCGGGCCAGCAGCCCCCGCGGAGGGTCACCAACGTGGGCTCCCTGCTGCTCACCCCGCAAGAGA
ACGAGTCTCTCTTCTCCTTCCTCGGCAAGAAATGTGTGACTATGTCTTCAGCAGTGGTGCAGTTGTATGC
AGCAGATCGGAACTGTATGTGGGCAAAGAAGTGCAGTGGTGTCGCTTGTCTGGTTAAGGACAATCCTCAG
AGATCTTATTTTTTAAGAATATTTGACATTAAGGATGGGAAATTACTGTGGGAACAAGAGCTATACAATA
ACTTTGTATATAATAGTCCTAGAGGATATTTTCATACCTTTGCTGGAGATACTTGTCAAGTAGCTCTTAA
TTTTGCCAATGAAGAAGAAGCAAAAAAGTTCCGAAAAGCAGTTACAGACCTGTTGGGCCGACGACAAAGG
AAATCTGCCTTAAGAACTGTCCTGAAGGTCCCAGCCTGTACCATTTTGCTGAGACATAGCCGCACCCTCA
ACTCCTGGACTCATGCTGTTTCTAACCACCATGCAGTCATTAACGCTAACAGGGAGGACATTCCTCGGAG
GAAAAGAGCCCTCCACTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG224732 representing NM_001167745
Red=Cloning site Green=Tags(s)

MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQ
RSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQR
KSALRTVLKVPACTILLRHSRTLNSWTHAVSNHHAVINANREDIPRRKRALHC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001167745
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001167745.1, NP_001161217.1
RefSeq Size 1304 bp
RefSeq ORF 582 bp
Locus ID 73178
Cytogenetics 6 A3.1
Gene Summary Regulates actin polymerization by stimulating the actin-nucleating activity of the Arp2/3 complex. Involved in various processes, such as mitosis and cytokinesis, via its role in the regulation of actin polymerization. Together with CDC42, involved in the extension and maintenance of the formation of thin, actin-rich surface projections called filopodia. In addition to its role in the cytoplasm, also plays a role in the nucleus by regulating gene transcription, probably by promoting nuclear actin polymerization (By similarity). Binds to HSF1/HSTF1 and forms a complex on heat shock promoter elements (HSE) that negatively regulates HSP90 expression (PubMed:12871950). Plays a role in dendrite spine morphogenesis (PubMed:25851601).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.