Prkag1 (NM_016781) Mouse Tagged ORF Clone

CAT#: MG204858

  • TrueORF®

Prkag1 (tGFP-tagged) - Mouse protein kinase, AMP-activated, gamma 1 non-catalytic subunit (Prkag1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_016781" in other vectors (4)

Reconstitution Protocol

USD 650.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Prkag1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Prkag1
Synonyms AA571379; BB036179; Prkaac
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204858 representing NM_016781
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCGGTTGCTGCAGAGAGCTCGCCAGCTCTAGAGAATGAACACTTTCAAGAGACCCCGGAATCAA
ACAATAGTGTGTATACTTCCTTCATGAAGTCTCATCGCTGCTATGACCTAATTCCCACAAGTTCCAAGTT
GGTGGTATTTGACACTTCGCTACAGGTAAAGAAAGCCTTTTTTGCCCTGGTGACCAATGGTGTTCGTGCC
GCCCCTTTGTGGGACAGTAAGAAGCAGAGTTTTGTGGGCATGCTGACCATCACCGACTTCATCAACATTT
TGCACCGATACTATAAGTCAGCCCTGGTGCAGATCTACGAACTGGAGGAGCACAAGATAGAGACGTGGAG
AGAGGTGTACCTGCAGGACTCCTTTAAGCCACTTGTCTGCATCTCTCCAAATGCCAGCTTGTTTGATGCT
GTCTCTTCATTAATTCGAAATAAGATCCACAGGCTCCCAGTTATCGACCCAGAGTCAGGCAACACCTTGT
ACATCCTTACTCACAAGCGGATCCTCAAGTTCCTCAAGTTGTTTATCACCGAGTTCCCCAAGCCGGAATT
CATGTCTAAGTCTCTCCAAGAGCTGCAGATTGGCACCTATGCCAATATTGCCATGGTCCGTACTACCACG
CCTGTCTACGTGGCTCTGGGCATCTTTGTACAGCACCGAGTCTCCGCCTTACCTGTAGTGGATGAGAAAG
GGCGTGTGGTGGACATCTACTCCAAGTTTGATGTGATCAATTTGGCAGCCGAAAAGACCTACAACAACCT
AGATGTGTCTGTGACAAAAGCCCTGCAGCATCGGTCCCACTACTTTGAGGGTGTTCTCAAATGCTACCTG
CATGAGACTCTGGAAACCATCATCAATAGGCTGGTGGAGGCAGAGGTTCACCGTCTGGTGGTGGTGGATG
AACACGACGTGGTCAAGGGCATCGTTTCGCTGTCTGACATCTTACAGGCTCTGGTGCTCACGGGTGGAGA
GAAGAAGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204858 representing NM_016781
Red=Cloning site Green=Tags(s)

MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRA
APLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDA
VSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTT
PVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYL
HETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016781
ORF Size 990 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016781.2, NP_058061.2
RefSeq Size 1680 bp
RefSeq ORF 993 bp
Locus ID 19082
UniProt ID O54950
Cytogenetics 15 54.73 cM
Gene Summary AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.