Elovl3 (BC016468) Mouse Tagged ORF Clone

CAT#: MG203622

  • TrueORF®

Elovl3 (tGFP-tagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 (cDNA clone MGC:18360


Reconstitution Protocol

USD 500.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Elovl3"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Elovl3
Synonyms Cig30; CIN-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG203622 representing BC016468
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACATCCATGAATTTCTCACGCGGGTTAAAAATGGACCTGATGCAACCCTATGACTTCGAGACGT
TTCAGGACTTAAGGCCCTTTTTGGAGGAGTACTGGGTAAGCTCATTTCTCATAGTGGTCGTCTATCTGTT
GCTCATCGTTGTTGGCCAGACCTACATGAGAACGCGGAAGAGCTTCAGCTTGCAGAGGCCTCTCATCCTC
TGGTCCTTCTTCCTGGCAATATTCAGTATCCTGGGTACTCTGAGGATGTGGAAGTTTATGGCAACAGTGA
TGTTTACAGTGGGCCTCAAGCAAACCGTGTGCTTTGCCATCTACACGGATGACGCCGTAGTCAGATTCTG
GTCCTTTCTCTTTCTTCTCAGCAAGGTTGTTGAACTGGGAGACACGGCCTTCATCATCCTGCGTAAGCGT
CCACTCATCTTTGTCCACTGGTACCACCACAGCACAGTGCTACTGTTCACAAGCTTTGGATACAAGAACA
AAGTGCCTTCGGGTGGCTGGTTCATGACCATGAACTTTGGCGTCCATTCTGTCATGTACACTTACTACAC
TATGAAGGCTGCCAAACTGAAGCATCCTAATCTTCTCCCCATGGTCATCACCAGCCTGCAGATTCTGCAG
ATGGTTCTGGGCACCATCTTTGGCATACTGAATTACATCTGGAGGCAGGAGAAAGGATGCCACACAACAA
CGGAACACTTCTTCTGGTCTTTTATGCTATATGGGACCTATTTCATCCTATTCGCTCACTTCTTCCACCG
AGCCTACCTCAGGCCCAAGGGCAAAGTTGCATCCAAGAGCCAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG203622 representing BC016468
Red=Cloning site Green=Tags(s)

MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLIL
WSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKR
PLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQ
MVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC016468
ORF Size 815 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC016468, AAH16468
RefSeq Size 1502 bp
RefSeq ORF 815 bp
Locus ID 12686
Cytogenetics 19 38.75 cM
Gene Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that exhibits activity toward saturated and unsaturated acyl-CoA substrates with higher activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Participates in the formation of certain VLCFA and triglycerides in certain cells of the hair follicles and the sebaceous glands, required for skin barrier function. Critical enzyme for lipid accumulation and metabolic activity in brown adipocytes during the early phase of the tissue recruitment. Plays a role in lipid storage and in resistance to diet-induced obesity.[UniProtKB/Swiss-Prot Function]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.