Mouse Fxyd3 (BC002039) AAV Particle

CAT#: MR200202A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Fxyd3 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:6001 IMAGE:3488180), 250ul, >10^13 GC/mL

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50 ul
    • 50 ul

USD 427.00


pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 850.00

Other products for "Fxyd3"

Specifications

Product Data
Tag Myc-DDK
Symbol Fxyd3
Synonyms Mat8
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR200202 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAGAGGTTGTTCTGAGCCTGTTGGTCCTTCTAGCAGGCCTGCCTACTTTGGATGCCAATGACCCTG
AAAATAAAAATGATCCTTTCTACTATGATTGGTACAGCCTCCGAGTCGGCGGGCTCATTTGTGCAGGGAT
TCTCTGTGCCCTGGGCATTATAGTCCTTATGAGTGGCAAATGCAAATGCAAGTTCAGACAGAAACCCAGT
CACCGCCCAGGAGAAGGGCCACCTCTCATCACACCAGGCTCAGCTCACAACTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200202 protein sequence
Red=Cloning site Green=Tags(s)

MQEVVLSLLVLLAGLPTLDANDPENKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPS
HRPGEGPPLITPGSAHNC

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN BC002039
ORF Size 264 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq BC002039, AAH02039
RefSeq Size 503 bp
RefSeq ORF 266 bp
Locus ID 17178
Cytogenetics 7 B1
MW 9.5 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.