GPR32 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "GPR32"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB,1:500 - 1:2000 IHC,1:100 - 1:200 |
Reactivities | Human, Mouse, Rat |
Modifications | Unmodified |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR32 (NP_001497.1): MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY |
Formulation | Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Concentration | lot specific |
Purification | Affinity purification |
Conjugation | Unconjugated |
Storage | Store at -20℃. Avoid freeze / thaw cycles. |
Stability | Shelf life: one year from despatch. |
Predicted Protein Size | 40kDa |
Gene Name | G protein-coupled receptor 32 |
Database Link | |
Background | This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19. |
Synonyms | RVDR1 |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.