GPR32 Rabbit Polyclonal Antibody

CAT#: TA376736

GPR32 Rabbit polyclonal Antibody

Product Images

Western blot analysis of extracts of A-549 cells, using GPR32 antibody (TA376736) at 1:1000 dilution.|Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.|Lysates/proteins: 25ug per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit .|Exposure time: 90s.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB,1:500 - 1:2000
  IHC,1:100 - 1:200
• Reactivities: Human, Mouse, Rat
• Modifications: Unmodified
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR32 (NP_001497.1): MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY
• Formulation: Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3.
• Concentration: lot specific
• Purification: Affinity purification
• Conjugation: Unconjugated
• Storage: Store at -20℃. Avoid freeze / thaw cycles.
• Stability: Shelf life: one year from despatch.
• Predicted Protein Size: 40kDa
• Gene Name: G protein-coupled receptor 32
• Database Link:
  Entrez Gene 2854 Human
  UniProt ID O75388
• Background: This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19.
• Synonyms: RVDR1