NUDT18 Rabbit Polyclonal Antibody

CAT#: TA346833

Rabbit Polyclonal Anti-NUDT18 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18), 20 µg
    • 20 ug

USD 867.00

Other products for "NUDT18"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the C terminal of human NUDT18. Synthetic peptide located within the following region: KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name nudix hydrolase 18
Background The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012]
Synonyms MTH3
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Horse: 92%; Dog: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.