Myozenin 1 (MYOZ1) Rabbit Polyclonal Antibody

CAT#: TA346637

Rabbit Polyclonal Anti-MYOZ1 Antibody

Product Images

WB Suggested Anti-MYOZ1 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYOZ1 antibody: synthetic peptide directed towards the middle region of human MYOZ1. Synthetic peptide located within the following region: TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: myozenin 1
• Database Link:
  NP_067068
  Entrez Gene 58529 Human
  UniProt ID Q9NP98
• Background: The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]
• Synonyms: CS-2; FATZ; MYOZ
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Dog: 86%; Zebrafish: 83%; Goat: 79%; Sheep: 79%